Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5gmkA_

Fold library idPDB HeaderMoleculeTitle
c5gmkA_3.40PDB header: rna binding protein/rnaChain: A: PDB Molecule: pre-mrna-splicing factor 8;


Added to library: Thu Feb 9 12:51:40 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LYTPKAEMPPEHLRKIINTHSDMASKMYNTDKKAFLGALKYLPHAILKLLENMPHPWEQAKEVKVLYHTS
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)






B
TT

SGGGGGGTT


SS
S

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence GAITFVNETPRVIEPVYTAQWSATWIAMRREKRDRTHFKRMRFPPFDDDEPPLSYEQHIENIEPLDPINL
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) S







S





SSSS
TTS



TTTTTTTS







 .........150.........160.........170.........180.........190.........200.........210
Sequence PLDSQDDEYVKDWLYDSRPLEEDSKKVNGTSYKKWSFDLPEMSNLYRLSTPLRDEVTDKNYYYLFDKKSF
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)


SSTTTTTTTTTTSSSS

S
SSSSS
TT

S
B

TGGGS




GGG
SS
S
 .........220.........230.........240.........250.........260.........270.........280
Sequence FNGKALNNAIPGGPKFEPLYPREEEEDYNEFNSIDRVIFRVPIRSEYKVAFPHLYNSRPRSVRIPWYNNP
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) TT


TTS




SS








STT
GGG



S


SSSS

S








 .........290.........300.........310.........320.........330.........340.........350
Sequence VSCIIQNDEEYDTPALFFDPSLNPIGDFTLPEDFAPLLAEEEELILPNTKDAMSLYHSPFPFNRTKGKMV
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)







S
SSS
SS


TTS








TT


TTTTS

S

TTTS
SSB


 .........360.........370.........380.........390.........400.........410.........420
Sequence RAQDVALAKKWFLQHPDEEYPVKVKVSYQKLLKNYVLNELHPTLPTNHNKTKLLKSLKNTKYFQQTTIDW
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) GGG

SSS


SSS
S




TTTT

TTSTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence VEAGLQLCRQGHNMLNLLIHRKGLTYLHLDYNFNLKPTKTLTTKERKKSRLGNSFHLMRELLKMMKLIVD
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) TT

S
TT

SS


T


 .........500.........510.........520.........530.........540.........550.........560
Sequence THVQFRLGNVDAFQLADGIHYILNHIGQLTGIYRYKYKVMHQIRACKDLKHIIYYKFNKNLGKGPGCGFW
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TTSS
ST
GGGT
GGGTTTTTS
SSS




 .........570.........580.........590.........600.........610.........620.........630
Sequence QPAWRVWLNFLRGTIPLLERYIGNLITRQFEGRSNEIVKTTTKQRLDAYYDLELRNSVMDDILEMMPESI
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)


S






TTTS
SS
 .........640.........650.........660.........670.........680.........690.........700
Sequence RQKKARTILQHLSEAWRCWKANIPWDVPGMPAPIKKIIERYIKSKADAWVSAAHYNRERIKRGAHVEKTM
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)
TT




SS

TT
S

 .........710.........720.........730.........740.........750.........760.........770
Sequence VKKNLGRLTRLWIKNEQERQRQIQKNGPEITPEEATTIFSVMVEWLESRSFSPIPFPPLTYKNDTKILVL
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)

SS
TT


B



SS
TT
 .........780.........790.........800.........810.........820.........830.........840
Sequence ALEDLKDVYASKVRLNASEREELALIEEAYDNPHDTLNRIKKYLLTQRVFKPVDITMMENYQNISPVYSV
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) S
SS











SSS


 .........850.........860.........870.........880.........890.........900.........910
Sequence DPLEKITDAYLDQYLWYEADQRKLFPNWIKPSDSEIPPLLVYKWTQGINNLSEIWDVSRGQSAVLLETTL
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
TT
S
TTB
S
SS

STTTT

SSS

 .........920.........930.........940.........950.........960.........970.........980
Sequence GEMAEKIDFTLLNRLLRLIVDPNIADYITAKNNVVINFKDMSHVNKYGLIRGLKFASFIFQYYGLVIDLL
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP)
S
TTT

B
T

TT

SS

TTSTT
 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence LLGQERATDLAGPANNPNEFMQFKSKEVEKAHPIRLYTRYLDRIYMLFHFEEDEGEELTDEYLAENPDPN
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
S

SSS


SS

S
TSSTT
S

TT
 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence FENSIGYNNRKCWPKDSRMRLIRQDVNLGRAVFWEIQSRVPTSLTSIKWENAFVSVYSKNNPNLLFSMCG
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
GGGTS



SSS
TTTS



S
TTT



TTT
BTTB

TT
 .........1130.........1140.........1150.........1160.........1170.........1180.........1190
Sequence FEVRILPRQRMEEVVSNDEGVWDLVDERTKQRTAKAYLKVSEEEIKKFDSRIRGILMASGSTTFTKVAAK
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) GGGGSS




TT
SSS



SS

S
 .........1200.........1210.........1220.........1230.........1240.........1250.........1260
Sequence WNTSLISLFTYFREAIVATEPLLDILVKGETRIQNRVKLGLNSKMPTRFPPAVFYTPKELGGLGMISASH
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) TTGGGG
TSS


TTT

TS
GGGTS







 .........1270.........1280.........1290.........1300.........1310.........1320.........1330
Sequence ILIPASDLSWSKQTDTGITHFRAGMTHEDEKLIPTIFRYITTWENEFLDSQRVWAEYATKRQEAIQQNRR
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) S



TTTTTTS










SS





GGGTS

TT

 .........1340.........1350.........1360.........1370.........1380.........1390.........1400
Sequence LAFEELEGSWDRGIPRISTLFQRDRHTLAYDRGHRIRREFKQYSLERNSPFWWTNSHHDGKLWNLNAYRT
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)

SSTTGGGTT
TTTTGGGGG
TTTT



SS

S

S







T
 .........1410.........1420.........1430.........1440.........1450.........1460.........1470
Sequence DVIQALGGIETILEHTLFKGTGFNSWEGLFWEKSQIPNRRFTLWWSPTINRANVYVGFLVQLDLTGIFLH
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TTTTSSSTTTS

S
STTB







TS
TT
SS


SSS

 .........1480.........1490.........1500.........1510.........1520.........1530.........1540
Sequence GKIPTLKISLIQIFRAHLWQKIHESIVFDICQILDGELDVLQIESVTKETVHPRKSYKMNSSAADITMES
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) S

S
TTTTBS





TTTTT

S



S

B
 .........1550.........1560.........1570.........1580.........1590.........1600.........1610
Sequence VHEWEVSKPSLLHETNDSFKGLITNKMWFDVQLRYGDYDSHDISRYVRAKFLDYTTDNVSMYPSPTGVMI
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) SS



TT




TTSS




SS


SSSS

SSS

 .........1620.........1630.........1640.........1650.........1660.........1670.........1680
Sequence GIDLAYNMYDAYGNWFNGLKPLIQNSMRTIMKANPALYVLRERIRKGLQIYQSSYAELFNNDIKLFVDDT
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) TTTT


TT
T

B


GGGGSSS

T
 .........1690.........1700.........1710.........1720.........1730.........1740.........1750
Sequence NVYRVTVHKTFEGNVATKAINGCIFTLNPKTGHLFLKIIHTSVWAGQKRLSQLAKWKTAEEVSALVRSLP
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) TTS

SSS



TTT

GGGGGG
S
TTS
 .........1760.........1770.........1780.........1790.........1800.........1810.........1820
Sequence KEEQPKQIIVTRKAMLDPLEVHMLDFPNIAIRPTELRLPFSAAMSIDKLSDVVMKATEPQMVLFNIYDDW
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) GGGS
SS
STTGGG
TT

SS



GGGGGST

S
SSSS
 .........1830.........1840.........1850.........1860.........1870.........1880.........1890
Sequence LDRISSYTAFSRLTLLLRALKTNEESAKMILLSDPTITIKSYHLWPSFTDEQWITIESQMRDLILTEYGR
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TTTS
TTSSTTS


SS
SS



 .........1900.........1910
Sequence KYNVNISALTQTEIKDIILG
Predicted secondary structure








SS confidence



















Known secondary structure (DSSP)


GGG



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D