Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5gliA_

Fold library idPDB HeaderMoleculeTitle
c5gliA_2.50PDB header: signaling proteinChain: A: PDB Molecule: endothelin receptor subtype-b;


Added to library: Thu Feb 9 19:37:24 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLYIIYKNKCMRNGPNILIASLALGDLLHIVIA
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)





S
TSTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence IPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVL
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TS

S
TSSS



SSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence IWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYATAKDWWLFSFYFCLPLAITAFFYT
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TTTT
SS
SSSTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence LMTCEMLRKNIFEMLRIDEGGGSGGDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQ
Predicted secondary structure






















































SS confidence





































































Known secondary structure (DSSP) TT





TTTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence MGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYLNDHLKQRREVAKT
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP) TT
TT
SS

SSGGG

 .........360.........370.........380.........390.........400.........410.........420
Sequence VFCLVLVFALCWLPLHLARILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCANPIALYLVSKRFK
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP)

SSSTT
 .........
Sequence NAFKSALCC
Predicted secondary structure

SS confidence








Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D