Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5gjvF_

Fold library idPDB HeaderMoleculeTitle
c5gjvF_3.60PDB header: membrane proteinChain: F: PDB Molecule: voltage-dependent calcium channel subunit alpha-2/delta-1;


Added to library: Thu Feb 9 18:25:10 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence FPSAVTIKSWVDKMQEDLVTLAKTASGVHQLVDIYEKYQDLYTVEPNNARQLVEIAARDIEKLLSNRSKA
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP)


S


SS




T
 .........80.........90.........100.........110.........120.........130.........140
Sequence LVRLALEAEKVQAAHQWREDFASVVYYNAKDQRIKPVFIDDANFRRQVSYQHAAVHIPTDIYEGSTIVLN
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) S













TT







TTTT
SS



TTS
SS
TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence ELNWTSALDDVFKKNREEDPSLLWQVFGSATGLARYYPASPWVKIDLYDVRRRPWYIQGAASPKDMLILV
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) GGGSS




TTS
SS










GGG
TTTSSTTS



 .........220.........230.........240.........250.........260.........270.........280
Sequence DVSGSVSGLTLKLIRTSVSEMLETLSDDDFVNVASFNSNAQDVSCFQHLVQANVRNKKVLKDAVNNITAK
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
STTS
SGGG

SS
B

SSS
TTT
SS




TTGGG



 .........290.........300.........310.........320.........330.........340.........350
Sequence GITDYKKGFSFAFEQLLNYNVSRANCNKIIMLFTDGGEERAQEIFAKYNKDKKVRVFTFSVGQHNYDRGP
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) S


ST

TTS



S


S



SS


SS

S

 .........360.........370.........380.........390.........400.........410.........420
Sequence IQWMACENKGYYYEIPSIGAIRINTQEYLDVLGRPMVLAGDKAKQVQWTNVYLDALELGLVITGTLPVFN
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) TT

STTSTTTTTTTTTS



SSS
S
 .........430.........440.........450.........460.........470.........480.........490
Sequence ITGQFENKTNLKNQLILGVMGVDVSLEDIKRLTPRFTLCPNGYYFAIDPNGYVLLHPNLQPKPIGVGIPT
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)
SSTTS

S

S
SSTTS

SSS
TT
B

BTTTSS
TT

SS



S


 .........500.........510.........520.........530.........540.........550.........560
Sequence INLRKRRPNVQNPKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYIDKGNRTYT
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)

SSS

S












BS


TTTT
S

TTSS
 .........570.........580.........590.........600.........610.........620.........630
Sequence WTPVNGTDYSSLALVLPTYSFYYIKAKIEETITQARYSETLKPDNFEESGYTFLAPRDYCSDLKPSDNNT
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)
SS
SS
TT
S





SSSTSGGGTTTT





SS



SS
 .........640.........650.........660.........670.........680.........690.........700
Sequence EFLLNFNEFIDRKTTDLINRVLLDAGFTNELVQNYWSKQKNIKGVKARFVVTDGGITRVYPKEAGENWQE
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)


TTTT
S
SS
B

TTSSSSSGGGG

S
 .........710.........720.........730.........740.........750.........760.........770
Sequence NPETYEDSFYKRSLDNDNYVFTAPYFNKSGPGAYESGIMVSKAVEIYIQGKLLKPAVVGIKIDVNSWIEN
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
S
TTS
TT
SSB

B


SS
SS

STTT


B
STT

B


 .........780.........790.........800.........810.........820.........830.........840
Sequence FTKTSIRMDCVILDDGGFLLMANHDDYTNQIGRFFGEIDPSLMRHLVNISVYAFNKSYDYQSVCEPGAAS
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TT




TTSBSSSSSTTSTTSBGGGT
TSSSTT






 .........850.........860.........870.........880.........890.........900.........910
Sequence KQSCITEQTQYFFDNDSKSFSGVLDCGNCSRIFHVEKLMNTNLIFIMVESKGTCPCDTRLLIQAEQTSDG
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)






S

SS
TTBT

SSS









S

 .........920.........930.........940.
Sequence PDPCDMVKQPRYRKGPDVCFDNNVLEDYTDC
Predicted secondary structure




























SS confidence






























Known secondary structure (DSSP) S
TTS






S





S







Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D