Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5gjvA_

Fold library idPDB HeaderMoleculeTitle
c5gjvA_3.60PDB header: membrane proteinChain: A: PDB Molecule: voltage-dependent l-type calcium channel subunit alpha-1s;


Added to library: Thu Feb 9 13:04:53 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence FCLTLQNPLRKACISIVEWKPFETIILLTIFANCVALAVYLPMPEDDNNSLNLGLEKLEYFFLTVFSIEA
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)






STTTSSTTTS



TTS


S
 .........80.........90.........100.........110.........120.........130.........140
Sequence AMKIIAYGFLFHQDAYLRSGWNVLDFIIVFLGVFTAILVKALRAFRVLRPLRLVSGVPSLQVVLNSIFKA
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) T
GGG

ST


STTTGGGGTSTTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence MLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTCYYIGTDIVATVENEKPSPCARTGSGRPCTINGSECR
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) TTTTTTTT



BBTTSS
B


TT






SSTTS



SSSB


 .........220.........230.........240.........250.........260.........270.........280
Sequence GGWPGPNHGITHFDNFGFSMLTVYQCITMEGWTDVLYWVNDAIGNEWPWIYFVTLILLGSFFILNLVLGV
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) SS


STTS
S
S
STTTSST
SSST
 .........290.........300.........310.........320.........330.........340.........350
Sequence LSGEFTKEREKAKSRGTFQKLREKQQLEEDLRGYMSWITQGEVMWNRVFRWKCHDLVKSRVFYWLVILIV
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) TGGGTT



TTTTSSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence ALNTLSIASEHHNQPLWLTHLQDIANRVLLSLFTIEMLLKMYGLGLRQYFMSIFNRFDCFVVCSGILELL
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) TT


SS
TTTT
S
 .........430.........440.........450.........460.........470.........480.........490
Sequence LVESGAMTPLGISVLRCIRLLRLFKITKYWTSLSNLVASLLNSIRSIASLLLLLFLFIIIFALLGMQLFG
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP)



GGGGGGGGG

TTTTTTTTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence GRYDFEDTEVRRSNFDNFPQALISVFQVLTGEDWNSVMYNGIMAYGGPSYPGVLVCIYFIILFVCGNYIL
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) T


TT

S


S

SSTTS
TTSSSSTTTGGGTTTT
 .........570.........580.........590.........600.........610.........620.........630
Sequence LNVFLAIAVDNLAEAESVRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRAESVRNQILGYFDIAFT
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TTTTTGGG

T
S


S
SSS
 .........640.........650.........660.........670.........680.........690.........700
Sequence SVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLISMGLVVKILRVLRVLRPLRAINRAKGLKH
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) TTS
GGGGGS


SGGGGTTT
ST
 .........710.........720.........730.........740.........750.........760.........770
Sequence VVQCVFVAIRTIGNIVLVTTLLQFMFACIGVQLFKGKFFSCNDLSKMTEEECRGYYYVYKDGDPTQMELR
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) SSS
SSSTT

SSTTS
S
SS
TT
 .........780.........790.........800.........810.........820.........830.........840
Sequence PRQWIHNDFHFDNVLSAMMSLFTVSTFEGWPQLLYRAIDSNEEDMGPVYNNRVEMAIFFIIYIILIAFFM
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)


SS


STTTTSSS

STT



SS

GGGGS
 .........850.........860.........870.........880.........890.........900.........910
Sequence MNIFVGFVIVTFQEQGETEYKNCELDKNQRQCVQYALKARPLRCYIPKNPYQYQVWYVVTSSYFEYLMFA
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) TTTSS

SS
STT










TST
 .........920.........930.........940.........950.........960.........970.........980
Sequence LIMLNTICLGMQHYHQSEEMNHISDILNVAFTIIFTLEMILKLLAFKARGYFGDPWNVFDFLIVIGSIID
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP)


SS

TTTTTTTS
 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence VILSEIDTFRISSAFFRLFRVMRLIKLLSRAEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMF
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP) T

GGGGTTTGGGGGTTTT
TTTS
 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence GKIALVDGTQINRNNNFQTFPQAVLLLFRCATGEAWQEILLACSYGKLCDPESDYAPGEEYTCGTNFAYY
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)
S



TTSSS
TTS
SSSTTSSSSSS



TTS


SS

S



TTS
 .........1130.........1140.........1150.........1160.........1170.........1180.........1190
Sequence YFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRI
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) TT

TTSS


SS
S
SSTSS
 .........1200.........1210.........1220.........1230.........1240.........1250.........1260
Sequence QPPLGFGKFCPHRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIKTEGNFEQANEELRAIIKKIWK
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)
TTTS

SS
S
SSTT



GGG
TTS


STT
S
 .........1270......
Sequence RTSMKLLDQVIPPIGD
Predicted secondary structure







SS confidence















Known secondary structure (DSSP)



TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D