Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5gjqZ_

Fold library idPDB HeaderMoleculeTitle
c5gjqZ_4.50PDB header: hydrolaseChain: Z: PDB Molecule: 26s proteasome non-atpase regulatory subunit 2;


Added to library: Thu Feb 9 13:25:57 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LKEIYENMAPGENKRFAADIISVLAMTMSGERECLKYRLVGSQEELASWGHEYVRHLAGEVAKEWVQREP
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)

STTS



SSTTTT
SST
SSSSSSS






 .........80.........90.........100.........110.........120.........130.........140
Sequence LLTLVKEIVPYNMAHNAEHEACDLLMEIEQVDMLEKDIDENAYAKVCLYLTSCVNYVPEPENSALLRCAL
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) TT


STT

TTS
SSS

TTTSSSS


GGGTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence GVFRKFSRFPEALRLALMLNDMELVEDIFTSCKDVVVQKQMAFMLGRHEDVEEYEDLTEIMSNVQLNSNF
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)
SSTTTSSSS

ST

S

SSSTTT

S
SSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence LALARELDIMEPKVPDDIYKTHLENNRFGGSGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDDGNKWLY
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)


TTTTTSS








S
TTTS

TTTTTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence KNKDHGMLSAAASLGMILLWDVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYV
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) S
STSS
S


SSSS
TTTS

SSS
T
 .........360.........370.........380.........390.........400.........410.........420
Sequence LHNSNTMRLGSIFGLGLAYAGSNREDVLTLLLPVMGDSKSSMEVAGVTALACGMIAVGSCNGDVTSTILQ
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)


STTT



TTTT
TTSTTS

 .........430.........440.........450.........460.........470.........480.........490
Sequence TIMEKSETELKDTYARWLPLGLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAYAGSGNVLKVQ
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TTTT
TT

STTTT
GGG
GGGGGGTTTS
STTTTTTTTSS
SS

TTTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence QLLHICSEAVLGIALIAMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFS
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)


TTSS
SS




TTSS
TTS

ST
 .........570.........580.........590.........600.........610.........620.........630
Sequence HDADPEVSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCPYHSD
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) SSS
TTT
BTTB


SSTTTT

B

SSSTT
 .........640.........650.........660.........670.........680.........690.........700
Sequence RQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPLPVSVRVGQPVLLAH
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

S

TTTTTSSSS
S



S
GGGGT
B
S



SS
SS




S




S

T
 .........710.........720.........730..
Sequence GERAELATEEFLPVTPILEGFVILRKNPNYDL
Predicted secondary structure





















SS confidence































Known secondary structure (DSSP) T


SS


SSB
SSS

SS

B

TTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D