Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ghrA_

Fold library idPDB HeaderMoleculeTitle
c5ghrA_2.51PDB header: dna binding protein/replicationChain: A: PDB Molecule: ssdna-specific exonuclease;


Added to library: Thu Feb 9 16:22:47 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence XDKEAFLERVREGAELIKXHIELGHTIRLISHRDADGITAGAILAKAVAREGGTFQLSIVKQVSEELIDQ
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)

TT

SSTT

S


 .........80.........90.........100.........110.........120.........130.........140
Sequence LAREKREIYVFSDLGSGSIELIEEKLNFATVVVADHHPPEKDSFSTDSHVLVNPVPFGANSVRDLSGSGV
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)

SS

GGGSTTS

S

SSSS
SSTT
SGGGT

TTTT

 .........150.........160.........170.........180.........190.........200.........210
Sequence AYFVAREXNRKNRDXAYVAIVGAVGDXQEIDGTFHGLNLEIIEDGKELGILEVRKELRLFGRESRPLYQX
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
GGGGGGTTTTTTSS

TTTS

SS
TTTSB
 .........220.........230.........240.........250.........260.........270.........280
Sequence LAYATNPEIPEITGDERKAIEWLRAKGFDPEXKYWQLREEEKRKLHEALLVHXIKHGAPKEAIDRLIGDV
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) T

SS

TTTSS
TT

TTSBGGGS
TT

TTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence VISPLYPEGDVRHEAREFATLLNATGRLNAGTLGVAICLGDEEAYKVARKXLDDYKKEQIEARKFIIQNW
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
TTS
TTSGGGBTT
TT
TG
 .........360.........370.........380.........390.........400.........410.........420
Sequence NXVEEGEHAYVFYAGKNIRDTLVGIAANXAINAPVVVLADSDEDENLVKGSARTTEKALEKGYHLGEALK
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) GG
B

SS

TTSS
TTT



SS
SS

T


 .........430.........440.........450.......
Sequence EVAEKLGGEGGGHAIAAGIRFPKNRIDEFIKLFNEAL
Predicted secondary structure









SS confidence




































Known secondary structure (DSSP) TTS


B
SSGGGT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D