Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5g5zA_

Fold library idPDB HeaderMoleculeTitle
c5g5zA_2.01PDB header: transport proteinChain: A: PDB Molecule: abc transporter, substrate-binding protein;


Added to library: Thu Feb 9 16:48:46 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KTLKFMTASSPLSPKDPNEKLILQRLEKETGVHIDWTNYQSDFAEKRNLDISSGDLPDAIHNDGASDVDL
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)


TTS
SSGGGS


SSTT


ST



 .........80.........90.........100.........110.........120.........130.........140
Sequence MNWAKKGVIIPVEDLIDKYMPNLKKILDEKPEYKALMTAPDGHIYSFPWIEELGDGKESIHSVNDMAWIN
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TTSB




B
TTS
B




S

GGGSTTS
SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence KDWLKKLGLEMPKTTDDLIKVLEAFKNGDPNGNGEADEIPFSFISGNGNEDFKFLFAAFGIGDNDDHLVV
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) T




B
TT
SSS





SSSTT
SGGGGGGGSS


TTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence GNDGKVDFTADNDNYKEGVKFIRQLQEKGLIDKEAFEHDWNSYIAKGHDQKFGVYFTWDKNNVTGSNESY
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
TTS
GGGSTT
B
TTTTT

TT
S
GGGTT
SSTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence DVLPVLAGPSGQKHVARTNGMGFARDKMVITSVNKNLELTAKWIDAQYAPLQSVQNNWGTYGDDKQQNIF
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)



B
TT










SS
SBTT
S
TS

S

SSS

S
 .........360.........370.........380.........390.........400.........410.........420
Sequence ELDQASNSLKHLPLNGTAPAELRQKTEVGGPLAILDSYYGKVTTMPDDAKWRLDLIKEYYVPYMSNVNNY
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) TTTT


TT




SS
GGGBTTTB


TGGG


S


 .........430.........440.........450.........460.........470.........480.........490
Sequence PRVFMTQEDLDKIAHIEADMNDYIYRKRAEWIVNGNIDTEWDDYKKELEKYGLSDYLAIKQKYYDQYQAN
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)







TT
 .
Sequence K
Predicted secondary structure
SS confidence
Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D