Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5g5hB_

Fold library idPDB HeaderMoleculeTitle
c5g5hB_2.30PDB header: oxidoreductaseChain: B: PDB Molecule: putative xanthine dehydrogenase yags fad-binding subunit;


Added to library: Thu Feb 9 20:25:22 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MKAFTYERVNTPAEAALSAQRVPGAKFIAGGTNLLDLMKLEIETPTHLIDVNGLGLDKIEVTDAGGLRIG
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)




SSSTTSS
TTTTSS

S
TTSS



TTSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence ALVRNTDLAAHERVRRDYAVLSRALLAGASGQLRNQATTAGNLLQRTRCPYFYDTNQPCNKRLPGSGCAA
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) TT
B
SSS

BT





TTS
BTTTSTTS
BTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence LEGFSRQHAVVGVSEACIATHPSDMAVAMRLLDAVVETITPEGKTRSITLADFYHPPGKTPHIETALLPG
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TTS

TTS
SSS

SS






STT

TTS
GGGTB


TT
TT

BS

TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence ELIVAVTLPPPLGGKHIYRKVRDRASYAFALVSVAAIIQPDGSGRVALGGVAHKPWRIEAADAQLSQGAQ
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)

S


S
SSSSSS

S
TTS
SSSSS
B

TTGGG
 .........290.........300.........310......
Sequence AVYDTLFASAHPTAENTFKLLLAKRTLASVLAEARA
Predicted secondary structure










SS confidence



































Known secondary structure (DSSP) TTT



TTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D