Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5g4iA_

Fold library idPDB HeaderMoleculeTitle
c5g4iA_1.50PDB header: transferaseChain: A: PDB Molecule: phospholyase;


Added to library: Thu Feb 9 11:27:52 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DLLARRYATIGPHSPLFYRQPLELVSGSGVWLTDAQGKVYLDGYNNVPHVGHANPAVADAIYQQLLTVNL
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
TTT
S
S


SSS


BTTT

SS

SSTT
BT
TT


 .........80.........90.........100.........110.........120.........130.........140
Sequence HTRYLNSRVVEYAEALLSKFDGALERLFLTNSGSEANELALRIARQHTGNTGVLVSDFSYHGNTTSLAEI
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
TTS

TT

TT

SSS


TT



SSTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence TTGLTVHEPLGAHVRALRIPDVSGIAEVDVPVLLEQSLADVDAAIASLQAAGHGVSVFLFDPLFSTEGLL
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)

SS

SS


TT




TT

GGGTT




TT
TTTT

 .........220.........230.........240.........250.........260.........270.........280
Sequence QLPSGYIEGVATRVRAAGGLVISDEVQSGFGRTGSGMWGYQMFNVEPELVTMGKPMGNGHPIGAVVTTAE
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)


TTTT

TTTTTTTTSSSSSGGGGSS


S
GGGGTTS


 .........290.........300.........310.........320.........330.........340.........350
Sequence LLDEFGRHNMFFNTFAGNPVSSAAGLAVLRYMDQEDLMAKADQLGKYIRKRLENIAQRSGNVGSVRGRGL
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)




SSTT
TT
TTTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence FFGIDIIESDGSRNPAPALTKILIEDMRERGVLISRVGPHDNVLKMRPPLVFGREHADILLGQLELSLAS
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) B
SSSS

B
TT
STTS



TT

T
 ...
Sequence LPQ
Predicted secondary structure

SS confidence


Known secondary structure (DSSP) S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D