Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5g2rA_

Fold library idPDB HeaderMoleculeTitle
c5g2rA_2.45PDB header: transferaseChain: A: PDB Molecule: molybdopterin biosynthesis protein cnx1;


Added to library: Thu Feb 23 10:17:06 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TEMIPTEEALRIVFGVSKRLPPVIVSLYEALGKVLAEDIRAPDPLPPYPASVKDGYAVVASDGPGEYPVI
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)








TGGGTTS
S

SS
BSSS
SSS
TTT
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence TESRAGNDGLGVTVTPGTVAYVTTGGPIPDGADAVVQVEDTKVIGDVSKRVKILIQTKKGTDIRRVGCDI
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)
TT

S
S



TT

TT
B

TT

GGG





S


TTTT
TTSSB
 .........150.........160.........170.........180.........190.........200.........210
Sequence EKDATVLTTGERIGASEIGLLATAGVTMVKVYPMPIVAILSTGDELVEPTAGTLGRGQIRDSNRAMLVAA
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
TT

TT
B

TT






TT
TT

S

TT


 .........220.........230.........240.........250.........260.........270.........280
Sequence VMQQQCKVVDLGIVRDDRKELEKVLDEAVSSGVDIILTSGGVSMGDRDFVKPLLEEKGKVYFSKVLMKPG
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TT


S
TT
SS

SSSTT

S
BS
 .........290.........300.........310.........320.........330.........340.........350
Sequence KPLTFAEIRAKPLGKTVLAFGLPGNPVSCLVCFNIFVVPTIRQLAGWTSPHPLRVRLRLQEPIKSDPIRP
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)





SSTTT
S

S
SS


SSS
 .........360.........370.........380.........390.........400.........410.........
Sequence EFHRAIIKWKDNDGSGTPGFVAESTGHQMSSRLLSMRSANALLELPATGNVLSAGSSVSAIIVSDISAF
Predicted secondary structure





























SS confidence




































































Known secondary structure (DSSP) SS
SSSS

S


TT
GGGGTT


S



TT

S





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D