Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5fzpB_

Fold library idPDB HeaderMoleculeTitle
c5fzpB_1.70PDB header: signaling proteinChain: B: PDB Molecule: dispase autolysis-inducing protein;


Added to library: Thu Feb 9 15:59:45 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GWRAPSCTKVTGDGAVTFTTDDGATLAPTTGTLQSVSYTHGLVALDTPNTLLATHNDELQRSTDAGCTWT
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)




S
SSBBSSSSSSTTSS


BSS


SSB



SSTT
TTSSTTSB
 .........80.........90.........100.........110.........120.........130.........140
Sequence KVATLGSGSTWLTAATGGRAFAWEKNGGYLARVDGRTVTKLSSPSADIVGVGTDKARRDHVRLAGSDGQL
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)
S
SS
TTT
BTS

TT


S
SS
TT
TT
TTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence YDSTDAGATWKPLGKLAFGPGASVYTVSFDPADLDHAVAGGMTTGGAVTTDGGATWTAATGLSATAGGKS
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) SSTTSS
S

TT
TT

TTTTBSSTTSS

BSSSSSTT

 .........220.........230.........240.........250.........260.........270.........280
Sequence NLFAASVSPADRNVVYALGIDLVEAAPNSGAEGRHLYRSTDGGRTYTRIVDDTPDTELTNSTLLAPSPVD
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)
SS
TT
TTTT
TTS



SSSSSB

SSSS


TT


SS
 .........290.........300.........310.........320.........330.........340.
Sequence PNVLYFEYGTYFQAYGTDLYRYDARTGKVGKTHNAHDGISAIAFNPARPSVMYLGLEEVQI
Predicted secondary structure
































SS confidence




























































Known secondary structure (DSSP) TT
GGG
TTTTSSS
SS
TTSB



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D