Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5fwaA_

Fold library idPDB HeaderMoleculeTitle
c5fwaA_1.80PDB header: transferaseChain: A: PDB Molecule: protein arginine n-methyltransferase 2;


Added to library: Thu Feb 9 13:14:51 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DTWQDEEYFDSYGTLKLHLEMLADQPRTTKYHSVILQNKESLKDKVILDVGCGTGIISLFCAHHARPKAV
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)
TT
TTST
TTTTTTT
T
TT
S

S
 .........80.........90.........100.........110.........120.........130.........140
Sequence YAVEASDMAQHTSQLVLQNGFADTITVFQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDTWL
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)

STTT
TTT
S
TTT


SS



BTTBTTT
T
 .........150.........160.........170.........180.........190.........200.........210
Sequence KGDGIIWPTTAALHLVPCSAEKDYHSKVLFWDNAYEFNLSALKSLAIKEFFSRPKSNHILKPEDCLSEPC
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) S


TGGGGGBTTB

GGGSS



GGGB
S

 .........220.........230.........240.........250.........260.........270.........280
Sequence TILQLDMRTVQVPDLETMRGELRFDIQKAGTLHGFTAWFSVYFQSLEEGQPQQVLSTGPLHPTTHWKQTL
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TTT

GGGGS

S


SSTT



STTS


TT
 .........290.........300.........310.........320.........330.........
Sequence FMMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVSLSWVVTSALDPTSQRVGEKVFPIWW
Predicted secondary structure


























SS confidence


























































Known secondary structure (DSSP)
TT

SSSTT

SS
TT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D