Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5fqlA_

Fold library idPDB HeaderMoleculeTitle
c5fqlA_2.30PDB header: hydrolaseChain: A: PDB Molecule: iduronate-2-sulfatase;


Added to library: Thu Feb 9 23:27:05 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TDALNVLLIIVDDLRPSLGCYGDKLVRSPNIDQLASHSLLFQNAFAQQAVAPSRVSFLTGRRPDTTRLYD
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)



TT

S
SGGGT
SSS

TS
SS


T

T
SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence FNSYWRVHAGNFSTIPQYFKENGYVTMSVGKVFHPGISSNHTDDSPYSWSFPPYHPSSEKYENTKTCRGP
Predicted secondary structure
























































SS confidence





































































Known secondary structure (DSSP) SS

T




TT
SSS
SSGGGTTTTSTTTS
SS

B

GGGGGTTSS

T
 .........150.........160.........170.........180.........190.........200.........210
Sequence DGELHANLLCPVDVLDVPEGTLPDKQSTEQAIQLLEKMKTSASPFFLAVGYHKPHIPFRYPKEFQKLYPL
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) TS


S
GGGSGGGS
TT
SS

TTSSSGGGGGGS
G
 .........220.........230.........240.........250.........260.........270.........280
Sequence ENITLAPDPEVPDGLPPVAYNPWMDIRQREDVQALNISVPYGPIPVDFQRKIRQSYFASVSYLDTQVGRL
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) GG



S

S

TTS
GGG




SGGGSTT


TTT



 .........290.........300.........310.........320.........330.........340.........350
Sequence LSALDDLQLANSTIIAFTSDHGWALGEHGEWAKYSNFDVATHVPLIFYVPGRTASLPEAGEKLFPYLDPF
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP) TT
TTTS


SGGG
SSS
S

BTTTB



TT

SS



TT
 .........360.........370.........380.........390.........400.........410.........420
Sequence DSASQLMEPGRQSMDLVELVSLFPTLAGLAGLQVPPRCPVPSFHVELCREGKNLLKHFRPGNPRELIAYS
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) S

S
S



GGGTTS



B

SS
TT
SS
BSS


GGGG



GGGG
 .........430.........440.........450.........460.........470.........480.........490
Sequence QYPRPSDIPQWNSDKPSLKDIKIMGYSIRTIDYRYTVWVGFNPDEFLANFSDIHAGELYFVDSDPLQDHN
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP) S
SS

TTSSS

GGG


SSTTTTTTT
TT

S
 .........500......
Sequence MYNDSQGGDLFQLLMP
Predicted secondary structure





SS confidence















Known secondary structure (DSSP)
STT

S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D