Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5fq6I_

Fold library idPDB HeaderMoleculeTitle
c5fq6I_2.80PDB header: membrane proteinChain: I: PDB Molecule: susc/raga family tonb-linked outer membrane protein;


Added to library: Fri Feb 10 01:53:33 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KALGYAATSVGGEKIAESRTSDVMSSLAGKIAGVQISSTSSDPGASNSVIIRGVSSLSGTNQPLYVVDGV
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)


SS
T

SSSSGGGTTSSTTS
SSTT

SS


SSS



SSSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence PLNNSTVYSTDGLNSGYDFGNGANAINPDDVANMTILKGAAATALYGSRAANGVVMITTKSGRKEKGVGI
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) B




S
TTTSB
GGGGS
GGG

SS

TTT
GGGGG






SSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence EYNGGVQWSTVLRLPEFQNEFGMGWNGNHTELENGSWGPRFDGSMQLWGNVYNNSQKLKPYVAMPDNIKD
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)




B

SB
STT
SS
SSB
S
B



TT



TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence FFDAGFRYSNSLSFNGATDKSDYYVSFSQISDDGMIPTDADSYDKYTFSARGSHKAGALTFSSSLNYAYQ
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) T



SS
SSSTTSSTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence KNNFATTGQGLSMLNSLYQTPRDISIIGLEDQNDPFNTPGYYYTPYGVMNPYYILNNYLNEYESERFYGK
Predicted secondary structure





















































SS confidence





































































Known secondary structure (DSSP)


BSSSS
SS
TT

SGGG

TTSGGGSTTT
S

SS



 .........360.........370.........380.........390.........400.........410.........420
Sequence FQLDYEFLKYFKFTYRMGLDTTTGQSDKGKPNLYALYYEGTPNGEGQGSSSPFSGETGQYSEQITRRREI
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP) TTT

STTSTTTGGGGGG
TTTT


 .........430.........440.........450.........460.........470.........480.........490
Sequence NQDIMVNFNMPVNDFNINALVGFNGNERKVSYQYSEVNDLTIPTWFNLKNSGKTPIVEQHMELRRLMGVF
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TTSBSSSS


TTSBSS

 .........500.........510.........520.........530.........540.........550.........560
Sequence GQFEGSWKNMLYLTVTARNDWSSTLPKENRSFFYPGITGSFIFSELLNDNLQDVITFGKIRASWGKTGND
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TTTSSS
GGG
TTSSS
SSTTSS
 .........570.........580.........590.........600.........610.........620.........630
Sequence ADVYMVNPVYAQSSNRIPFGSLTFPLGGVNAYSAGNVLGSNTLSPEMTTESEVGLNMAFFKNRLSFDVSY
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)

SS
SS


TTS

SS



S

S



TTTT
 .........640.........650.........660.........670.........680.........690.........700
Sequence YNRNTDKQIFSLAMDPASGYTAQNMNLGKIRNRGIELLISGTPIRTKDFSWELTWNFTKNWSKVISLPEE
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) S


GGGSSS


SS



GG
 .........710.........720.........730.........740.........750.........760.........770
Sequence LGGITTIYGLNGGTSMYAITGMPVGVFKAQVAERDPQGRIVVNSSTGLPVEASEFGICGDMNNKYQMGVS
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) G
S
TTS
TTS
SS

B
B
TTS
B
TTT

B
B
SS
S

S
 .........780.........790.........800.........810.........820.........830.........840
Sequence TNLKYKGISLGIDFDIRQGGVMYSRTKDINYFTGNAIQTAYNDRNPLIVPNSVNKIVNGENVTYVENTTP
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) TT

T
BGGGGGGGG

B

TTSSS




 .........850.........860.........870.........880.........890.........900.........910
Sequence ITSSNIYKYWGDGGSDMGSCFLVDKSYVKLRSVVLGWDLPKRWLAKTPFQAVKVSAYGNNLFVWTPSSNT
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) B
GGGTTGGGGGGGG



GGGSSSSS
SS



TT

 .........920.........930.........940.......
Sequence FIDPEMTSFGNDLEGNYGEYTANPSSRRFGFNLMVKF
Predicted secondary structure
























SS confidence




































Known secondary structure (DSSP) S

SS

SS
SSGGGGGSS





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D