Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5foyB_

Fold library idPDB HeaderMoleculeTitle
c5foyB_2.25PDB header: toxinChain: B: PDB Molecule: larvicidal toxin 51 kda protein;


Added to library: Thu Feb 9 14:22:49 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TSLNYNLPEISKKFYNLKNKYSRNGYGLSKTEFPSSIENCPSNEYSIMYDNKDPRFLIRFLLDDGRYIIA
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)







GGGSSS
SS



SS


STT



SSB
SSSB


TTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence DRDDGEVFDEAPTYLDNNNHPIISRHYTGEERQKFEQVGSGDYITGEQFFQFYTQNKTRVLSNCRALDSR
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TTT


S


TTS





GGGS
GGGT

TTTTSS
SSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence TILLSTAKIFPIYPPASETQLTAFVNSSFYAAAIPQLPQTSLLENIPEPTSLDDSGVLPKDAVRAVKGSA
Predicted secondary structure






















































SS confidence





































































Known secondary structure (DSSP) S



TTTT
TGGGGG



















STT




GGG


 .........220.........230.........240.........250.........260.........270.........280
Sequence LLPCIIVHDPNLNNSDKMKFNTYYLLEYKEYWHQLWSQIIPAHQTVKIQERTGISEVVQNSMIEDLNMYI
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) GGG


TTS

S
TT


S
 .........290.........300.........310.........320.........330.........340.........350
Sequence GADFGMLFYFRSSGFKEQITRGLNRPLSQTTTQLGERVEEMEYYNSNDLDVRYVKYALAREFTLKRVNGE
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) BTTS

TTT

B
S
S
B



SSS

TT

 .........360.........370.........380.........390.........400.........410.........420
Sequence IVKNWVAVDYRLAGIQSYPNAPITNPLTLTKHTIIRCENSYDGHIFKTPLIFKNGEVIVKTNEELIPKIN
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) S
TTTS


S

TT


SS
TT

GGGS
S


 .
Sequence Q
Predicted secondary structure
SS confidence
Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D