Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5fgnA_

Fold library idPDB HeaderMoleculeTitle
c5fgnA_2.75PDB header: transferase,hydrolaseChain: A: PDB Molecule: lipooligosaccharide phosphoethanolamine transferase a;


Added to library: Thu Feb 23 10:20:09 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PKLGSSALIAFLSLYSSLVLNYAFFAKVVELHPFNGTGADIFLYTMPVVLFFLSNFVFHVIALPFVHKVL
Predicted secondary structure



SS confidence





































































Known secondary structure (DSSP)


SSTS
S


SSSTT

TTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence IPLILVISAAVSYQEIFFNIYFNKSMLNNVLQTTAAESARLITPGYVLWIVCLGVLPALAYIAVKVKYRV
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) T



S

TT

T




 .........150.........160.........170.........180.........190.........200.........210
Sequence WYKEFLTRLVLAAVSFLCALGIAMLQYQDYASFFRNNKSVTHLIVPSNFIGAGVSKYKDWKRSNIPYTQL
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) TT
TTGGGGSTTTT



B

 .........220.........230.........240.........250.........260.........270.........280
Sequence DMAVVQNRPAGSLRRFVVLVVGETTRAANWGLNGYSRQTTPLLAARGDEIVNFPQVRSCGTSTAHSLPCM
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)
TT



TT



S

GGG
GGGT
SS
S
TGGG
S

S
SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence FSTFDRTDYDEIKAEHQDNLLDIVQRAGVEVTWLENDSGCKGVCGKVPNTDVTSLNLPEYCRNGECLDNI
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP) TSS

GGG

TB

TT

SS

TTSSTTS
GGGG

TTTTT
GGG
 .........360.........370.........380.........390.........400.........410.........420
Sequence LLTKFDEVLNKNDKDAVLILHTIGSHGPTYYERYTEAERKFTPTCDTNEINKCTRATLVNTYDNTVLYVD
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) GGGTTS
SS


TT
SS
GGGSS
GGG

S
S


SS
TTTS
 .........430.........440.........450.........460.........470.........480.........490
Sequence QFIDKVIRKLENRDDLESVVHYVSDHGESLGENGMYLHAAPYAIAPSGQTHIPMVMWFSKAFRQHGGIDF
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TTTT
TT
S


SGGG
S


TTT

B


S
B
 .........500.........510.........520.........530......
Sequence QCLKQKAAENEYSHDHYFSTVLGLMDISNSQTYRKEMDILAACRRP
Predicted secondary structure




























SS confidence













































Known secondary structure (DSSP)

GGGTTTS
SS

GGG
TTGGGB


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D