Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5fcrA_

Fold library idPDB HeaderMoleculeTitle
c5fcrA_1.25PDB header: hydrolaseChain: A: PDB Molecule: complement factor d;


Added to library: Thu Feb 9 13:13:13 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ILGGQEAAAHARPYMASVQVNGTHVCGGTLLDEQWVLSAAHCMDGVTDDDSVQVLLGAHSLSAPEPYKRW
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
BS


TTSSTTTT
SSS
GGGGTT

TTS
S
SBSSS

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence YDVQSVVPHPGSRPDSLEDDLILFKLSQNASLGPHVRPLPLQYEDKEVEPGTLCDVAGWGVVTHAGRRPD
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP)
TT

TT
STT

SS



BTTB



B

S




TT

S
SSTT



S
 .........150.........160.........170.........180.........190.........200.........210
Sequence VLHQLRVSIMNRTTCNLRTYHDGVVTINMMCAESNRRDTCRGDSGSPLVCGDAVEGVVTWGSRVCGNGKK
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) B

TSTTTTTT


TT

SSSB

TT
TT
TT

TTS
SS
TTS
 .........220.........230
Sequence PGVYTRVSSYRMWIENITNG
Predicted secondary structure



SS confidence



















Known secondary structure (DSSP)
SGGG


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D