Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5f7vA_

Fold library idPDB HeaderMoleculeTitle
c5f7vA_1.40PDB header: cycloalternan binding proteinChain: A: PDB Molecule: lmo0181 protein;


Added to library: Thu Feb 9 16:42:37 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DKTEITYYQFSAPGKALDEMVKEFEKQNPDIKVNVQTIAFNDYFTKLQTQIAGGDAPDAFELNYETFMQY
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)

SS



TT

TT


S
 .........80.........90.........100.........110.........120.........130.........140
Sequence AEKGVLADLTSYIEKDKDFDPSTLNKQAYDAFKYDGKQYGMVESFSNVVTIYNKDLFDKAGVEYPTADWT
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) T
B



TT

GGGB
TTTT
S
T




TT
B
 .........150.........160.........170.........180.........190.........200.........210
Sequence WKDEEAAAKKLTDAKNKVWGTSQPVTMNEFYKVAAQNGGSIFNEDLTETTINSPENVEALTHLTNEVTDS
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
BGGGTB


STTT

SB
TTSS
B
TT
TS
 .........220.........230.........240.........250.........260.........270.........280
Sequence KVAPSPADLSGQLPEDLFMNGQIAMLHTGIWLFDMFQDAPFKWDVQVEAGNTQKATHFFANGIGVSKDSD
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)

S

TTS
TT
GGGTT
SS



BSSS


BTT
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence KKEAAFKFASFMSANEEAAKIRIDNNWELPATENKEILQPYLDATPPDNREAVFESLQYMVLPPVVKDWN
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)

TT
SSB



SSS
TGGGG




TT
 .........360.........370.........380........
Sequence KISDYTNSEFEKVLNGDSTPEKALKNSEDNINKTMGFK
Predicted secondary structure







SS confidence





































Known secondary structure (DSSP) TTS

T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D