Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5f7pA_

Fold library idPDB HeaderMoleculeTitle
c5f7pA_2.84PDB header: transcriptionChain: A: PDB Molecule: lmo0178 protein;


Added to library: Thu Feb 9 20:57:29 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DINRYTVLNLIREKGEITRTEIAKKCDFGMSTLTYILDDLQQEGIILEGKLVRFNKDYGFVVSVKVEEEQ
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)
STSSS
TS


TTS

SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence LLFALTDLNAEIIENTSIPFSSEEAIELIAKNVKKMCGNRDMNHLLGVGIAISGLVNRKKGTVIRSTMLG
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
TT





TTT

TTSSSTTTTGGGT
 .........150.........160.........170.........180.........190.........200.........210
Sequence WENVALEAMLHAHFPDIPVYVDKNINCYTLAELWLGEGKQSNNFATVSVGAGLGLSVVINRQIYYGAQGG
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
TT
SSS
SGGGT
SS
SS
BSSSSB

TTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence AGEFGHTTIQPGGYKCHCGQKGCLEMYASEFYFRNRGEELKEAYPLNDFHFDKVAKSARAGDEMATELMG
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TT
GGGSBSSTT
SB
TTSSBSBGGGTSSTTT





STT
 .........290.........300.........310.........320.........330.........340.........350
Sequence KMGEYLGYGIRNIINTFNPEKVIIVGEGLHHRDLFLTKIDEIASQNFFSGAGFETEITTTSLEDPAWLQG
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)

SSS
GGGS
TSSTT



S

T
 .........
Sequence AALLVIHQL
Predicted secondary structure

SS confidence








Known secondary structure (DSSP) TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D