Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5f30B_

Fold library idPDB HeaderMoleculeTitle
c5f30B_1.45PDB header: oxidoreductaseChain: B: PDB Molecule: thiocyanate dehydrogenase;


Added to library: Thu Feb 9 15:21:20 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KYVKVQDFYDQLGKYVLVAPGKFSGTVAATDLSTGWTMAWLAAWNYGDTCPIMHHMAAFPSPDPYKEFEF
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)



TT
S

BTT
TTT

GGGGT
SS



S
TTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence VVNTQGGKNLFIYGVPVTVEDPGEGMKIYRIKYDGTRMNLQRDAAEVSGLGLGVHVTITPEADGYAVGDG
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)
GGGGGSSSS



SS



SS
SB


S

TTSST
 .........150.........160.........170.........180.........190.........200.........210
Sequence QKDICAEFDRETDMVRYAWAFDWDPNVKDLKRAWLDGGTMTIKRLKPTLPGGRYDLQGSKGNKIDWELVP
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) TTTTTT

SSSSTTTTTTT




BGGGB
SB
TTTT
SSSS


T
 .........220.........230.........240.........250.........260.........270.........280
Sequence GGELAIEDGKVSGDRPLHSVANDALVFDPRGKWAVASMRLPGVCVVFDRENQVPVAVLAGPKGTPSQFQL
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TTT
S
SS
GGG



TTSSTTTTTTTT
STTS
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence VKVDDDTWTVDIPEVISAGHQAGFSPDGQSFLFMNSLRQNNIMVWDSSNHDDPTTWEKKAVVESPDWRGA
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TTS

S


TTSS
SSS



TT
GGG


TTS
SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence YPNTFHMVFTPDAKKIYVTMWWPSPTPNGIAVIDAVNWEVLKEVDLGPDMHTLAITYDGKFVVGTLSGYQ
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)

B



TTSSB
STTS
TTTTS

TTS
GGG
 .........430.........440.........450.........460.......
Sequence NTASAIVVMETETDEVLGFLPSPMGHHDNVIVPRTLEDLRISRSTTT
Predicted secondary structure
























SS confidence














































Known secondary structure (DSSP) TS
TTT



S

S



SSTTSTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D