Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5eznA_

Fold library idPDB HeaderMoleculeTitle
c5eznA_2.51PDB header: immune systemChain: A: PDB Molecule: pfcyrpa;


Added to library: Fri Feb 10 06:44:57 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HVFIRTELSFIKNNVPCIRDMFFIYKRELYNICLDDDETHIYVQKKVKDSWITLNDLFKETDLTGRPHIF
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)

SS

SS

TT



TTTTTTS


S

 .........80.........90.........100.........110.........120.........130.........140
Sequence AYVDVEEIIILLCEDEEKKDMTCHRFYSNDGKEYQNSEITISDYILKDKLLSSYVSLPLKIENREYFLIC
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
SS






SSSSS

B


TT
TTTT
B





SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence GVSPYKFKKDDILCMASHDKGETWGTKIVIKYDNYKLGVQYFFLRPYISKNDLSFHFYVGDNINNVKNVN
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)


S



SSSTTS





S
SS

TT

STT


 .........220.........230.........240.........250.........260.........270.........280
Sequence FIECTHEKDLEFVCSNRDFLKDNKVLQDVSTLNDEYIVSYGNDNNFAECYIFFNNENSILIKPEKYGQTT
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) SSSS




TT
SSSSSSTT
S
TTT




SSS
 .........290.........300.........310........
Sequence AGCYGGTFVKIDEQRTLFIYSSSQGIYNIHTIYYANYE
Predicted secondary structure














SS confidence





































Known secondary structure (DSSP)


TT

SSS
SSTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D