Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5elnC_

Fold library idPDB HeaderMoleculeTitle
c5elnC_1.90PDB header: ligaseChain: C: PDB Molecule: lysine--trna ligase;


Added to library: Thu Feb 9 17:08:02 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SHYTDNRYKMMECIKDAGRPFYPHKFKISMSLPAYALKYGNVENGYIDKDTTLSLSGRVTSIRSSSSKLI
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
TT


S
S



SS
TTS
TT
B
TT

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence FYDIFCEEQKVQIIANIMEHDISTGEFSVSHSEIRRGDVVGFTGFPGKSKRGELSLFSKSVVLLSPCYHM
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TTGGG

GGG

T

TT

TTS



S
 .........150.........160.........170.........180.........190.........200.........210
Sequence LPTAIDQEVRYRQRYLDLMLNEESRKVFKLRSRAIKYIRNYFDRLGFLEVETPMLNMIYGGAAARPFITY
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)

S


S
TT




SSS

SSSS


 .........220.........230.........240.........250.........260.........270.........280
Sequence HNELETQLYMRIAPELYLKQLIVGGLDKVYEIGKNFRNEGIDLTHNPEFTAMEFYMAYADYYDLMDLTEE
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TTTT
S
STT



S

BTTB
ST

 .........290.........300.........310.........320.........330.........340.........350
Sequence LISGLVLEIHGSLKIPYHPDGPEGKCIEIDFTTPWKRFSFVEEIESGLGEKLKRPLDSQENIDFMVEMCE
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) SSS
TT
TTS



SS
TS


SSTTS
 .........360.........370.........380.........390.........400.........410.........420
Sequence KHEIELPHPRTAAKLLDKLAGHFVETKCTNPSFIIDHPQTMSPLAKWHREKPEMTERFELFVLGKELCNA
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TT



SS

TGGG
SSS

BGGG
TTB
B
SSSTTBBSTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence YTELNEPLQQRKFFEQQADAKASGDVEACPIDETFCLALEHGLPPTGGWGLGIDRLIMFLADKNNIKEVI
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) B


TT
TT




TTT

ST
SSGGGSS
 ........
Sequence LFPAMRNK
Predicted secondary structure







SS confidence







Known secondary structure (DSSP) SS






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D