Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5edlA_

Fold library idPDB HeaderMoleculeTitle
c5edlA_1.95PDB header: transport proteinChain: A: PDB Molecule: putative hmp/thiamine permease protein ykoe;


Added to library: Thu Feb 9 21:27:44 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SWKVKEIVIMSVISIVFAVVYLLFTHFGNVLAGMFGPIAYEPIYGIWFIVSVIAAYMIRKPGAALVSEII
Predicted secondary structure




SS confidence





































































Known secondary structure (DSSP)



GGGGGGGGGGGG
STT
 .........80.........90.........100.........110.........120.........130.........140
Sequence AALVECLLGNPSGPMVIVIGIVQGLGAEAVFLATRWKAYSLPVLMLAGMGSSVASFIYDLFVSGYAAYSP
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) TT
TTTTTTT


SSSGGGS
 .........150.........160.........170.........180.........190.......
Sequence GYLLIMLVIRLISGALLAGLLGKAVSDSLAYTGVLNGMALGKELKKKRKRASEHASL
Predicted secondary structure











SS confidence
























































Known secondary structure (DSSP) TTTTTTTTSTT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D