Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5e7pA_

Fold library idPDB HeaderMoleculeTitle
c5e7pA_2.51PDB header: hydrolaseChain: A: PDB Molecule: cell division control protein cdc48;


Added to library: Thu Feb 9 13:33:04 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TPLSHLRLTARLNTSALDSRRGVVRLHPEVLAALGIREWDAVALTGTRTTAAVAGVAGPGVPAGTALLDD
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)







TTTSSSS
T

TT
SSS

TT

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence VTLSNAGVRENAAVLVSPVTVYGARSVTVSGSRLATQSISPATLRMALLGKVMTVGDTVSLLPRDSAATS
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) T

TT



S

S
TTT
TT
S
S


 .........150.........160.........170.........180.........190.........200.........210
Sequence ALASSVGITWTSELLTVTAVDPPGTVSVQPNSVVSWGTGTPEDPAPPPTGRHTVSPQRSEQPVSFDDVKV
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP) T

S


SSS

TT




SSS





S


TT


SS
T
 .........220.........230.........240.........250.........260.........270.........280
Sequence THPQAVKLDEWLRLSLDEPELLKTLGATPHLGVLVSGPAGVGKATMVRAVCASRRVVELDGPEVGALQVD
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) T
TT
T

S


STTSSTTTS
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence ERLRSVTSAVAAVTESGGVLFIADVDALLPAGNEMRPPEPVATLILAELRKAVATPGVAFIATSAVPENV
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)
TTTTTSB


SSS


TTSTT
SSGGGB
 .........360.........370.........380.........390.........400.........410.........420
Sequence DARLRAPEVCDRELGLSLPDATARRSLLEMLLRGVPSEDLDLGDIADHTPGFVVADLAAVVREGALRAAA
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
TTTSSTTS






TTT

BS


T
TT

 .........430.........440.........450.........460.........470.........480.........490
Sequence RASSSDDDPVLRHADLEGALTVIRPLSRSAEVSVGSVTLDDVGDMVETKRALTEAVLWPLQHPDTFSRLG
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
S


B
TTT


GGG



STTS

GGGS
S
T
TT
 .........500.........510.........520.........530.........540.........550.........560
Sequence IDPPRGVLLYGPPGCGKTFVVRALASSGRLSVHAVKGSELMDKWVGSSEKAVRELFARARDSAPSLVFLD
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)






TTSSTTTTSSSSTSSS
T
S
 .........570.........580.........590.........600.........610.........620.........630
Sequence EIDALAPRRGQNFDSGVTDKVVASLLTELDGIEPLRDVVVLGATNRPDLIDPALLRPGRLERLVFVEPPD
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TSB
TTS

STTTT
SSS
GGGB
GGGGSTTS




 .........640.........650.........660.........670.........680.........690.........700
Sequence AAARRDILRTAGKSIPLADDVDLDSLADDLDGYSAADCVALLRESAMTAMRRSIDAADVTAADVAKARET
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TTTS
B
TT


TT


STT
SB
 .........710.........
Sequence VRPSLDPAQVESLREFAEK
Predicted secondary structure






SS confidence


















Known secondary structure (DSSP) S




TTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D