Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5e5cC_

Fold library idPDB HeaderMoleculeTitle
c5e5cC_2.10PDB header: hydrolaseChain: C: PDB Molecule: d-hydantoinase/dihydropyrimidinase;


Added to library: Thu Feb 9 12:58:06 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MSLLIRGATVVTHEESYRADVLCANGLIQAIGENLETPSGCDVLDGGGQYLMPGGIDPHTHMQLPFMGTV
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)

S

SS

TTTT



TT

TTS

TT
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence ASEDFFSGTAAGLAGGTTSIIDFVIPNPRQSLLEAFHTWRGWAQKSAADYGFHVAITWWSDEVAREMGEL
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
S

TT


TT

TT
SS


S

 .........150.........160.........170.........180.........190.........200.........210
Sequence VAQHGVNSFHFMAYKNAIMAADDTLVASFERCLELGAVPTVHAENGELVFHLQQKLLAQGLTGPEAHPLS
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)


B

BS

TTTT


T
B
B


TT

STTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence RPPQVEGEAASRAIRIAETLGTPLYLVHISSREALDEIAYARAKGQPVYGEVLAGHLLLDDSVYRHPDWA
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) S
T






TT


BGGGGG
SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence TAAGYVMSPPFRPVEHQEALWRGLQSGNLHTTATDHCCFCAEQKAMGRDDFSKIPNGTAGIEDRMALLWD
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) T

SS

B
TTS



B



GGGTT
GGGS


B

TTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence AGVNSGRLSMHEFVALTSTNTAKIFNLFPRKGAIRVGADADLVLWDPQGSRTLSAATHHQRVDFNIFEGR
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TTTTSS
TTT
TTTSS

STTSB



TTT
SSSSS

TTTT
 .........430.........440.........450.........460.........470........
Sequence TVRGIPSHTISQGKLLWAAGDLRAEPGAGRYVERPAYPSVYEVLGRRAERQRPVAVER
Predicted secondary structure

























SS confidence

























































Known secondary structure (DSSP) TTTT


TT


B



S

TT







Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D