Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5dwzC_

Fold library idPDB HeaderMoleculeTitle
c5dwzC_2.04PDB header: transferaseChain: C: PDB Molecule: 3-oxoacyl-[acyl-carrier-protein] synthase 3;


Added to library: Sat Feb 6 09:00:12 2016
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GHKVKLAAITCELPARSYENDDPVFAAVPDLSESWWQFWGVNRRGYFDPRNGENEFSLVVRAAERLLRSS
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)




S
TT
GGGTTS



T




GGGT
STTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence DTAPDSVDMLICSASSPIMTDAGDVLPDLRGRLYPRMANVLSKQLGLSRALPLDSQMEAASFLLNLRLAA
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) T

GGG


SSS
B


TTTSTT

SBSSS
ST
TT



GGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence SMIRQGKAEKVLVVCSEYISNLLDFTSRTSTLFADGCAVALLTRGDDDSCDLLASAEHSDATFYEVATGR
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TTS
S

TTT

TTSGGGGTB


SSSSS

TTGGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence WRLPAKPRLYFSLFSDNKMASFVPTNVPIAMRRALEKAGLGSDDIDYFVFHQPAPFLVKAWAEGIGARPE
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)










SS
TTST

GGG



S
T

GG
 .........290.........300.........310.........320.........330.........340
Sequence QYQLTMGDTGVMISVSIPYTLMTGLREGKIRPGDRIVMAGAATGWGFAAQVWQLGEVLVC
Predicted secondary structure























SS confidence



























































Known secondary structure (DSSP) GS



B
GGGTTSS
TT
TTT





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D