Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5dwzC_

Fold library idPDB HeaderMoleculeTitle
c5dwzC_2.04PDB header: transferaseChain: C: PDB Molecule: 3-oxoacyl-[acyl-carrier-protein] synthase 3;


Added to library: Sat Feb 6 09:00:12 2016
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GHKVKLAAITCELPARSYENDDPVFAAVPDLSESWWQFWGVNRRGYFDPRNGENEFSLVVRAAERLLRSS
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)




S
TT
GGGTTS



T




GGGT
STTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence DTAPDSVDMLICSASSPIMTDAGDVLPDLRGRLYPRMANVLSKQLGLSRALPLDSQMEAASFLLNLRLAA
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) T

GGG


SSS
B


TTTSTT

SBSSS
ST
TT



GGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence SMIRQGKAEKVLVVCSEYISNLLDFTSRTSTLFADGCAVALLTRGDDDSCDLLASAEHSDATFYEVATGR
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TTS
S

TTT

TTSGGGGTB


SSSSS

TTGGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence WRLPAKPRLYFSLFSDNKMASFVPTNVPIAMRRALEKAGLGSDDIDYFVFHQPAPFLVKAWAEGIGARPE
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)










SS
TTST

GGG



S
T

GG
 .........290.........300.........310.........320.........330.........340
Sequence QYQLTMGDTGVMISVSIPYTLMTGLREGKIRPGDRIVMAGAATGWGFAAQVWQLGEVLVC
Predicted secondary structure























SS confidence



























































Known secondary structure (DSSP) GS



B
GGGTTSS
TT
TTT





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D