Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5dmyA_

Fold library idPDB HeaderMoleculeTitle
c5dmyA_1.95PDB header: hydrolaseChain: A: PDB Molecule: beta-galactosidase;


Added to library: Thu Feb 9 13:29:09 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SSAVDSKQNRTSDFDANWKFMLSDSVQAQDPAFDDSAWQQVDLPHDYSITQKYSQSNEAESAYLPGGTGW
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP)


TTS
S

SS
SS



STT


TTS
SS

SSTTS


TTSBGGGTT


 .........80.........90.........100.........110.........120.........130.........140
Sequence YRKSFTIDRDLAGKRIAINFDGVYMNATVWFNGVKLGTHPYGYSPFSFDLTGNAKFGGENTIVVKVENRL
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
GGGTTSS

BS
TT

SSS

GGG

TT
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence PSSRWYSGSGIYRDVTLTVTDGVHVGNNGVAIKTPSLATQNGGNVTMNLTTKVANDTEAAANITLKQTVF
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) S

SS



B

S

S
TTTTS
SSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence PKGGKTDAAIGTVTTASKSIAAGASADVTSTITAASPKLWSIKNPNLYTVRTEVLNGDTVLDTYDTEYGF
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TT

GGG
S



TT
S

BB
SSSB

TT
B
 .........290.........300.........310.........320.........330.........340.........350
Sequence RWTGFDATSGFSLNGEKVKLKGVSMHHDQGSLGAVANRRAIERQVEILQKMGVNSIRTTHNPAAKALIDV
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

TTTTT



S

GGGTT


TT


TTS


 .........360.........370.........380.........390.........400.........410.........420
Sequence CNEKGVLVVEEVFDMWNRSKNGNTEDYGKWFGQTIAGDNAVLGGDKDETWAKFDLTSTINRDRNAPSVIM
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) T


SS
SS

TT
TTSGGGTTT



TT


BSS

SS
TT
TT
 .........430.........440.........450.........460.........470.........480.........490
Sequence WSLGNEMMEGISGSVSDFPATSAKLVAWTKAADSTRPMTYGDNKIKANWNESNTMGDNLTANGGVVGTNY
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) STTSS

S

TT
TTS
SSTTTT
TT

S
 .........500.........510.........520.........530.........540.........550.........560
Sequence SDGANYDKIRTTHPSWAIYGSETASAINSRGIYNRTTGSDKQLTSYDNSAVGWGAVASSAWYDVVQRDFV
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)


TT


B


TT

S
S



S


SSS

B
TTS

T
TT
 .........570.........580.........590.........600.........610.........620.........630
Sequence AGTYVWTGFDYLGEPTPWNGTGSGAVGSWPSPKNSYFGIVDTAGFPKDTYYFYQSQWNDDVHTLHILPAW
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)
SB

BS

TTS

SSBS
SSSSS


B
S

SB
TTS
B
T
TTSS

 .........640.........650.........660.........670.........680.........690.........700
Sequence NENVVAKGSGNKVPVVVYTDAAKVKLYFTPKGSTEKRLIGEKSFTKKTTAAGYTYQVYEGTDKDSTAHKN
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP)
TTT


BGGG

STT
S


TTS

STT

SSGGGG
 .........710.........720.........730.........740.........750.........760.........770
Sequence MYLTWNVPWAEGTISAEAYDENNRLIPEGSTEGNASVTTTGKAAKLKADADRKTITADGKDLSYIEVDVT
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) GS

S
TTS
B

GGGS
S


S

S
S
SS

 .........780.........790.........800.........810.........820.........830.........840
Sequence DANGHIVPDAANRVTFDVKGAGKLVGVDNGSSPDHDSYQADNRKAFSGKVLAIVQSTKEAGEITVTAKAD
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
TTS
B
TT


S


TT

S
TTSS
BTT
SS

T
 .........850.....
Sequence GLQSSTVKIATTAVP
Predicted secondary structure





SS confidence














Known secondary structure (DSSP) TSB




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D