Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5dl6A_

Fold library idPDB HeaderMoleculeTitle
c5dl6A_2.90PDB header: membrane proteinChain: A: PDB Molecule: putative porin for vanillate trafficking (vanp);


Added to library: Sat Feb 6 08:23:02 2016
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EGSFIDNSSVELTTRNFYFDRDYQYPAAKDWTQGFILKANSGYTEGTIGFGLDVLATAGFKLDADAEHGG
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

S









SSSS

GGG

 .........80.........90.........100.........110.........120.........130.........140
Sequence TGNLPRDTRTNEPADSYGEIGVTAKAKMSQTELRIGTLMPMNPVLVASPARLLPQTYRGISLTSKDIKDF
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) SSSS
B
TTT

B
STT

BSSS
B


SSSS



STT
 .........150.........160.........170.........180.........190.........200.........210
Sequence DLQAAYLDKVNHRDSTNYEKIKISGVNGRFKGAETDGLYYLGGNYQFNPALKLTAFYMDVDDLYNQTMVG
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
TT
SS
BB

GGGSS


B
S
TTTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence ALHQYKINDTTNFSSQLRYYRSRDDGQAKAGLVDNDLYHAHFELKHQNHKFIFGTFQHHGDTAFPYLTGG
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
SSS


TT
TT



TTSSS



BSSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence ETGLLIDTWPGEFLNPKEKAYSFRYEYDFKEYVPGLCFMTRYTTGHNIYAPNLGGTNLKERETDFDLGYT
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)

SS
S

TT




TT

TTT
TTTTTT
 .........360.........370.........380.........390.....
Sequence VQSGWLKNLGLRARYAIYDNNMLSTANIKPVNETRINIDYTWKFK
Predicted secondary structure




















SS confidence












































Known secondary structure (DSSP)
SSTTTTSS
TTSSS




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D