Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5dl6A_

Fold library idPDB HeaderMoleculeTitle
c5dl6A_2.90PDB header: membrane proteinChain: A: PDB Molecule: putative porin for vanillate trafficking (vanp);


Added to library: Sat Feb 6 08:23:02 2016
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EGSFIDNSSVELTTRNFYFDRDYQYPAAKDWTQGFILKANSGYTEGTIGFGLDVLATAGFKLDADAEHGG
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

S









SSSS

GGG

 .........80.........90.........100.........110.........120.........130.........140
Sequence TGNLPRDTRTNEPADSYGEIGVTAKAKMSQTELRIGTLMPMNPVLVASPARLLPQTYRGISLTSKDIKDF
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) SSSS
B
TTT

B
STT

BSSS
B


SSSS



STT
 .........150.........160.........170.........180.........190.........200.........210
Sequence DLQAAYLDKVNHRDSTNYEKIKISGVNGRFKGAETDGLYYLGGNYQFNPALKLTAFYMDVDDLYNQTMVG
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
TT
SS
BB

GGGSS


B
S
TTTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence ALHQYKINDTTNFSSQLRYYRSRDDGQAKAGLVDNDLYHAHFELKHQNHKFIFGTFQHHGDTAFPYLTGG
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
SSS


TT
TT



TTSSS



BSSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence ETGLLIDTWPGEFLNPKEKAYSFRYEYDFKEYVPGLCFMTRYTTGHNIYAPNLGGTNLKERETDFDLGYT
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)

SS
S

TT




TT

TTT
TTTTTT
 .........360.........370.........380.........390.....
Sequence VQSGWLKNLGLRARYAIYDNNMLSTANIKPVNETRINIDYTWKFK
Predicted secondary structure




















SS confidence












































Known secondary structure (DSSP)
SSTTTTSS
TTSSS




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D