Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5dkuB_

Fold library idPDB HeaderMoleculeTitle
c5dkuB_2.90PDB header: transferaseChain: B: PDB Molecule: prex dna polymerase;


Added to library: Thu Feb 9 16:45:02 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DEITKKYIKDNIINVDDNIIKKKDIFKLKNENNEITECAFEYFESKKKFDDDIESRFFIINDNNYNENIN
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)

STTTBGGGT
SSS



SSSS

SS

SS
S



SSS

GGGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence LIYKDIKYCGLNIQTTGLEVFDENIRLIQIAVENYPVIIYDMFNINKKDILDGLRKVLENKNIIKIIQNG
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) GGTTT
SSSS
GGG


TTS
GGG



TTSSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence KFDAKFLLHNNFKIENIFDTYIASKLLDKNKNMYGFKLNNIVEKYLNVILDKQQQNSVWNNSLLNNNQLF
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TT




TTS
SS

ST





GGGGS

SSSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence YAARDSSCLLKLYKKLKEEIKKENLHIVNDIENKCILPICDMELNGIKVDLENLQKSTNEILNELNIEKD
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TT


 .........290.........300.........310.........320.........330.........340.........350
Sequence NLKKKLKIISLRNYRRLYKLYSAFYLKLPLHINTKTNKIHTTFNQLKTFSGRFSSEKPNLQQIPRQKNIR
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)


TTTTTGGGGS
TTT


SSSSSS


SS
GGGS


 .........360.........370.........380.........390.........400.........410.........420
Sequence EIFIPNDNNIFIIADFKQIELKIAAEITNDEIMLKAYNNNIDLHTLTASIITKKNIPDINKEDRHIAKAI
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TT

TTSST
TT




GGG

 .........430.........440.........450.........460.........470.........480.........490
Sequence NFGLIYGMNYVNLKNYANTYYGLNMSLDQCLYFYNSFFEHYKGIYKWHNQVKQKRALQYSTLSNRKVIFP
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) T


T







S
TT


S
 .........500.........510.........520.........530.........540.........550.........560
Sequence YFSFTKALNYPVQGTCADILKLALVDLYDNLKDINGKIILCVHDEIIIEVNKKFQEEALKILVQSMENSA
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) S

TTTTT
TTGGG
 .........570.........580.
Sequence SYFLKKVKCEVSVKIAENWGS
Predicted secondary structure










SS confidence




















Known secondary structure (DSSP)
SS



SSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D