Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5dijA_

Fold library idPDB HeaderMoleculeTitle
c5dijA_2.70PDB header: unknown functionChain: A: PDB Molecule: tqaa;


Added to library: Thu Feb 9 15:06:15 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EPFSLSPIKDPQALHKELCSKNVIPVTSTLEDLLPATQAQHVFIKRGTFHSYNWTIKGRSLNMDRLRETC
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
TTTT
SSSSTTSS
TT


TT
SS


 .........80.........90.........100.........110.........120.........130.........140
Sequence QSLVDRHSILRTSFVEHEGHPIQLVLANLDVKVREVQCWPGEDPMEVCKALWDGKDWPTLNVLGGSLPVR
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
GGGG
SSSS
S






TT

TTTTT

TTB


S
 .........150.........160.........170.........180.........190.........200.........210
Sequence FTLVSCPGNEHVVLTIQISHSQWDGVSIPKLFSDFAAIYNQTPLPPTSDFAHYLYHRVSSAREDVQQDPT
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)
TTSSTTS

TTTT







TS
SSGGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence FQFWRHYLDGAKMAVPFAPGQTLWTFKGIVPPTLPSGITMATLVKAATALFLSYHLGSRDVVFGHTVNGR
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TTT
















TT

T
S


 .........290.........300.........310.........320.........330.........340.........350
Sequence NLPMDNIESLLGCTLNFVPLRVTFPEDSTDWTVMDLLHHTQTQYTRALSHEHVELRDIFQHSTNWPAETP
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
SS
SSTTT

S





GGG

BTTTTTTTS

SS
TT

 .........360.........370.........380.........390.........400.........410.........420
Sequence LSLIVQHQNIDLSFSLPLRGLDVQYSKFARFDPLDEVWIFTEPHADRLEVQVCANSRVLGQEQATELANN
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
S

S

S











S

SS
TTTS
 .........430.........440.
Sequence ISAIITKFSTDPTARLLDITF
Predicted secondary structure







SS confidence




















Known secondary structure (DSSP)
TTSBGGG



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D