Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5dgkA_

Fold library idPDB HeaderMoleculeTitle
c5dgkA_2.90PDB header: replicationChain: A: PDB Molecule: active helicase;


Added to library: Thu Feb 9 13:55:00 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TLFEIGPFALDSFGWKETIPKVVRXASPIIVNARFSDPITGVEKLIITNNNGKKDIFESDILTTRNLPSL
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)

TTTT


S


TTT


SS

GGGGSTTTGGGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence IKYGYSINEKYIRSLSYALQLXRDRLPLSELYEGVGILETPFGYLISLDKVLKSIQFNQSSPSYPIVDSA
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) GTTT

B
GGGS


TTSSS


S



 .........150.........160.........170.........180.........190.........200.........210
Sequence YDLTPKGTFDNWFNXYIDEVKGHLLLELAVIFGISALVTSFLKHKHEIEFAGILFSFTGQSSTGKSTAAA
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) S



BS
TTT
TTS
S



SSSSSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence LAVSVAGNPTKGNETLFRSWNATRNALEGYLSNNYGIPIVFDELSSTDTTGLLYSIAEGQGRQTPKNWGT
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TTTS

SSSSS
SS
S
STTS


GGG


TT










 .........290.........300.........310.........320.........330.........340.........350
Sequence SVISTSEYSIFNDSAQNDGLRVRTIEINEQFTTNATNADNIKKAVALNYGHVLPLVAKYLINREDEVIQW
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
SS
SSSSS
S
S
S


SSSBSST
 .........360.........370.........380.........390.........400.........410.........420
Sequence FYKEVDWFEAKLKDETNNTGIRXFKRYAVITTSAKILGRVLSTDIDIANIRDYFIDYHTHTVSERSLADK
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TTT


TTT



TSGGGS
 .........430.........440.........450.........460.........470.........480.........490
Sequence AIDVIIQFVAQNRGKFSDEGALKNXFENYGLISLKDDHIEVKIIANVFKQXLNNHQFQDVNNVVNALRDK
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) GGGSSSS


SS


TTTT


T
 .........500.........510.........
Sequence GFILADRGRQTTVFYHLKLDVEFASILGL
Predicted secondary structure









SS confidence




























Known secondary structure (DSSP) TSB
SSSSS




GGGTTTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D