Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5df0A_

Fold library idPDB HeaderMoleculeTitle
c5df0A_3.25PDB header: hydrolaseChain: A: PDB Molecule: ac-chia;


Added to library: Thu Feb 9 11:14:11 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence IPGTPVIDWADRNYALVEINYEATAYENLIKPKEQVDVQVSWNVWNGDIGDIAYVLFDEQQVWKGDAESK
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)







S
TT

SSTTT
S
SS


SSSSSTTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence RATIKVLVSGQFNMRVKLCNEDGCSVSDPVLVKVADTDGGHLAPLEYTWLENNKPGRREDKIVAAYFVEW
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)
S

SS




TT
TTS







TT

S


SSSGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence GVYGRNFPVDKVPLPNLSHLLYGFIPICGGDGINDALKTISGSFESLQRSCKGREDFKVAIHDPWAAVQK
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP) GGSSS


GGGS
GGG
S
B


TTTSGGGGGSTTTSS

SS
B

S
TS
 .........220.........230.........240.........250.........260.........270.........280
Sequence PQKSVSAWNEPYKGNFGQLMAAKLANPHLKILPSIGGWTLSDPFYFMHDVEKRNVFVDSVKEFLQVWKFF
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
BTTB

TT
SS

TT

SSTTGGGGGTTSSSSTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence DGVDVDWEFPGGKGANPSLGDAERDAKTYILLLEELRAMLDDLEAQTGRVYELTSAISAGYDKIAVVNYA
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)

S
TTS
SS
TT


S




TTS
 .........360.........370.........380.........390.........400.........410.........420
Sequence EAQKSLGKIFLMSYDFKGAWSNTDLGYQTTVYAPSWNSEELYTTHYAVDALLKQGVDPNKIIVGVAMYGR
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) TTT
S


SS
TT
SSS


SS
SS

TT
TT
S
STT

GGGS
 .........430.........440.........450.........460.........470.........480.........490
Sequence GWTGVTNYTNDNYFSGTGNGPVSGTWEDGVVDYRQIQKDLNNYVYTFDSAAQASYVFDKSKGDLISFDSV
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) SS
BS

TT
TTSSB

SB


SSSTTTGGGSTTTTTTTT

 .........500.........510.........520........
Sequence DSVLGKVKYVDRNKLGGLFAWEIDADNGDLLNAINAQF
Predicted secondary structure









SS confidence





































Known secondary structure (DSSP) TTT


GGG

ST



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D