Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ddwD_

Fold library idPDB HeaderMoleculeTitle
c5ddwD_2.30PDB header: transferaseChain: D: PDB Molecule: crmg;


Added to library: Thu Feb 9 15:52:16 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EPVYADAVLNGWLTSMGLGVEYVRAEGNTVYYLDDEGREVPVLDHACGFGSLIFGHNHPEIIAHAKAALD
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)



S
TT



BT
TTS
SST
TT
BT
 .........80.........90.........100.........110.........120.........130.........140
Sequence AGTVVHAQLSRQPRANQISRILNDIMRRETGRDDRYNAIFANSGAEANEICMKHAELERQERITALFAEI
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TT

S

TTS






SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence DAELDTAREALTTGTATLDTASLPLVDVDGVIADIHRHNDERRAERPLFLTLDGSFHGKLVGSIQLTQNE
Predicted secondary structure


























































SS confidence





































































Known secondary structure (DSSP) SSS

GGGGGG

S

TT




STTGGGG


 .........220.........230.........240.........250.........260.........270.........280
Sequence PWRTPFTALSSPARFLPADEPELIGKIVEDERRSVLTLSLDKDTVRVVERDFPVVAAIFVEPVRGGSGMK
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) GGGTTTS


TT
GGGT
TT


SGGGTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence TVTPELAEELHRLRDTLGCPLVVDEVQTGIGRTGAFFGSALLGIRGDYYTLAKAIGGGIVKNSVALIRQD
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)





TTTTTTTTSSS
TT


S
GGGGTTTS

TT
 .........360.........370.........380.........390.........400.........410.........420
Sequence RFLPAMEVIHSSTFAKDGLSASIALKVLEMVEADGGRVYQRVRERGQRLEAMLESVRADHSDVVSAVWGT
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) T

TT


SSTT
T
TTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence GLMLALELRDQSNATSQAIREKAAHGFLGYVLAGFLLREHHIRVLPAGPRSGFLRFSPSLYITDEEIDRT
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TT


TT
SSTT



STTS



TT

 .........500.........510.
Sequence ETALRSLFTALRDQDGDRLVL
Predicted secondary structure







SS confidence




















Known secondary structure (DSSP) TT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D