Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5d9wA_

Fold library idPDB HeaderMoleculeTitle
c5d9wA_1.69PDB header: plant proteinChain: A: PDB Molecule: dehydroascorbate reductase;


Added to library: Sat Feb 6 08:36:39 2016
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GVEVCVKAAVGHPDTLGDSPFSQRVLLTLEEKKVPYEMKLIDVQNKPDWFLKISPEGKVPVFNGGDGKWI
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)
TT


TT


TTS

STT

S

SSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence PDSDVITQVIEEKYPTPSLVTPPEYASVGSKIFSCFTTFLKSKDPNDGSEKALLTELQALEEHLKAHGPF
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)


SS




GGGTTTTTT


TTSS
SB
 .........150.........160.........170.........180.........190.........200.........210
Sequence INGQNISAADLSLAPKLYHLQVALEHFKGWKIPEDLTNVHAYTEALFSRESFIKTKAAKEHLIAGWAPKV
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TTBSS






TT
TSS

 .
Sequence N
Predicted secondary structure
SS confidence
Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D