Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5d95A_

Fold library idPDB HeaderMoleculeTitle
c5d95A_1.90PDB header: transferaseChain: A: PDB Molecule: aminotransferase class-iii;


Added to library: Thu Feb 9 11:21:16 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GNVYREPGSAAADLFERARRVLPGGNTRTTVYSAPYPPYAARGRGAVIVDADGEERLDFVNNYTALIHGH
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)

GGGSTT
SGGG
S
GGG

SS



BTTTS
SSTTTTT
TT
B
 .........80.........90.........100.........110.........120.........130.........140
Sequence ADPDINEAVIRQLADGVAFAMPTEHEIALAELLTERVPSLQQVRFTNSGTEAVMMAIKAARAYTGRPRIA
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) S
TT
S

SS

STT
SSS


 .........150.........160.........170.........180.........190.........200.........210
Sequence KFDGCYHGSYDFAEVSTQSSGKPGEDGFPVATPYTGGTPQAVLDSVVVLPFNDIDGTERLIEQHRDELAA
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) TT



S
TTTSTTSS

SS

TTSS




SSTT

TT
TT
TTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence VLIDPNPRSLGLYPAEPAFLQRLREITRAYGIVLIFDEVISLRSDYGGMQSVLGVTPDLTAMGKIIGGGF
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)
SS
GGGTS



TT

TTGGGGSTTT


SGGGGTTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence PVGAVGGSAEVMSVFDPTPPRAPHGGTFNANPVTMVAGLTAMRKLTPAEFDRLATLGQQLRAGVEEVLRE
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) S

GGG




SS



TTTT


 .........360.........370.........380.........390.........400.........410.........420
Sequence AGVPGQVTGYGSLFHIHLHQRPLADYRNSVLSAQERAFVGRVHEALMGRGIFITPALFGCLSTPMGVPEV
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) SS


TTSS


TTSGGGG


TT

TT


TT

 .........430......
Sequence EAFVDAFAAALQDARG
Predicted secondary structure

SS confidence















Known secondary structure (DSSP) T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D