Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5d4wB_

Fold library idPDB HeaderMoleculeTitle
c5d4wB_3.70PDB header: chaperoneChain: B: PDB Molecule: putative heat shock protein;


Added to library: Thu Feb 9 12:18:39 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QENENLSKFCIDXTAXAREGKIDPVIGREEEIRRVIRILSRRTKNNPVLIGEPGVGKTTIVEGLAQRIVN
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)


TTT
S



S
TT
SSS


SSSSTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence ADVPDNLAACKLLSLDVGALVAGSKYRGEFEERXKGVLKEIQESKETIILFVDAIHLLXGAXDAANLLKP
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) T


SSS
S

TTT

SSSSSS
S
TTT




TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence XLARGQLHCIGATTLAEYRKYIEKDAAFERRFQQVLVKEPSISETISILRGLKEKYEVHHGVNIADAAIV
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TTTT



S
SS




TTTTTT



S
 .........220.........230.........240.........250.........260.........270.........280
Sequence AAANLAARYLTSRRLPDSAVDLIDEAAAAVRVARESQPEIIDSLERRLRQLKIEIHALSREKDEASKARL
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TTTSGGGT
TT

TTTTS
STT
 .........290.........300.........310.........320.........330.........340.........350
Sequence AQAKQDAQNVEEELRPLREKYERERQRGKAIQEAKXKLEALRVKAEDASRXGDHSRAADLQYYAIPEQEA
Predicted secondary structure

SS confidence





































































Known secondary structure (DSSP) TTTTSS

TTTTTTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence IIKRLEAEKAAADAALNANGADVGGSXITDVVGPDQINEIVARWTGIPVTRLKTSEKHXEQALSKIVVGQ
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) TTT
SSSS




S


SSSSSSSTTTTT


S


 .........430.........440.........450.........460.........470.........480.........490
Sequence KEAVQSVSNAIRLQRSGLSNPNQPPSFLFCGPSGTGKTLLTKALAEFLFDDPKSXIRFDXSEYQERHSLS
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) SS


SS



SSSSSTTSS
TTS


GGGG
S
 .........500.........510.........520.........530.........540.........550.........560
Sequence RXIGAPPGYVGHDAGGQLTEALRRRPFSILLFDAVEKAAKEVLTVLLQLXDDTDGQGRVVDAKNCIVVXT
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) S



SS
SSSSS

SSTT
SS


S
GGG

SS



SSS






S
 .........570.........580.........590.........600.........610.........620.........630
Sequence SNDPTTRELVXNTLRNYFLPEFLNRISSVVIFNRLTRREIRKIVDLRIAEIQKRLTDNDRNVIIKVSEEA
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)


TTTTS
TTSS




SSS




 .........640.........650.........660.........670.........680........
Sequence KDKLGAQGYSPVYGARPLQRLLEKEVLNRLAILILRGQIREGEVAHVELVDGKVQVLP
Predicted secondary structure



















SS confidence

























































Known secondary structure (DSSP) S
TTT
STTTTTSTSS
SSS

SSS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D