Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5d28A_

Fold library idPDB HeaderMoleculeTitle
c5d28A_2.85PDB header: viral proteinChain: A: PDB Molecule: gm-csf/il-2 inhibition factor;


Added to library: Thu Feb 9 11:06:11 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QWIGERDFCTAHAQDVFARLQVWMRIDRNVTAADNSSACALAIETPPSNFDADVYVAAAGINVSVSAINC
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)

S
TTT
B

TTTS






TT
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence GFFNMRQVETTYNTARRQMYVYMDSWDPWVIDDPQPLFSQEYENETLPYLLEVLELARLYIRVGCTVPGE
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)


TTSS

GGGSSS


SB
STT


TTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence QPFEVIPGIDYPHTGMEFLQHVLRPNRRFAPAKLHMDLEVDHRCVSAVHVKAFLQDACSARKARTPLYFA
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)
S












TTT
TT





TTS


TTTTTGGG
S

S
 .........220.........230.
Sequence GHGCNHPDSPISRKCSMQTAR
Predicted secondary structure

















SS confidence




















Known secondary structure (DSSP)










Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D