Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5czrC_

Fold library idPDB HeaderMoleculeTitle
c5czrC_2.30PDB header: cell adhesionChain: C: PDB Molecule: cadherin-related family member 2;


Added to library: Fri Feb 10 00:17:36 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NVAPKFLANMTSVILPEDLPVGAQAFWLVAEDQDNDPLTYGMSGPNAYFFAVTPKTGEVKLASALDYETL
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)




GGGGTT

TTS


TT



STTGGG
TTT

S


TTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence YTFKVTISVSDPYIQVQREMLVIVEDRNDNAPVFQNTAFSTSINETLPVGSVVFSVLAVDKDMGSAGMVV
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) S
SS


S








TT

TT




SSGGGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence YSIEKVIPSTGDSEHLFRILANGSIVLNGSLSYNNKSAFYQLELKACDLGGMYHNTFTIQCSLPVFLSIS
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) S

TTGGGT
TTS
S


TTTT
S

TT

B


 ......
Sequence VVDQPD
Predicted secondary structure

SS confidence





Known secondary structure (DSSP)




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D