Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
  Protein Homology/analogY Recognition Engine V 2.2
 

Fold library entry viewer: c5cwsJ_

Fold library idPDB HeaderMoleculeTitle
c5cwsJ_PDB header: protein transportChain: J: PDB Molecule: nucleoporin nup49;PDBTitle: crystal structure of the intact chaetomium thermophilum nsp1-nup49-2 nup57 channel nucleoporin heterotrimer bound to its nic96 nuclear3 pore complex attachment site


Added to library: Sat Oct 17 08:25:08 2015
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SEALQQEIAKIDEEIQKCIRDKEAVDAFLPAHGEQLAAIPTDVNFVTRKSEGAHNALSSDILAIDQLREL
Predicted secondary structure
SS confidence





































































Known secondary structure (DSSP)
 .........80.........90.........100.........110.........120.........130.........140
Sequence VKQDADNARLSFKAIDNLKLSNADLISYFSKTADEMEEMMKKFEKTITEIEAHLTGVEAHAMAMQNVAVD
Predicted secondary structure
SS confidence





































































Known secondary structure (DSSP)

TTT

 .........150.........160.........170.........180
Sequence ERVYELAAVLREFEESILKVAGVVGGVKEGVTELQLRDFM
Predicted secondary structure



SS confidence







































Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: Phyre2.2: A Community Resource for Template-based Protein Structure Prediction
Powell HR et al. Journal of Molecular Biology (2025) in press DOI: https://doi.org/10.1016/j.jmb.2025.168960
 
© Structural Bioinformatics Group, Imperial College, London
Michael Sternberg  
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D