Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5cw2C_

Fold library idPDB HeaderMoleculeTitle
c5cw2C_2.00PDB header: hydrolaseChain: C: PDB Molecule: putative epoxide hydrolase epha;


Added to library: Thu Feb 9 16:57:36 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TPSERSVETNGVRLRLVEAGERGDPLVVLAHGFPELAYSWRHQIPALVDAGYHVMAPDQRGYGGSSAPEA
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)

TTS
TTS


TT

GGGGTTTTT

TTSTTS


S
 .........80.........90.........100.........110.........120.........130.........140
Sequence IEAYDITRLTADLMGLLDDIGAEKAAFIGHDWGALVVWNAALLYPDRVAAVAGLSVPPVPRSLTRPTEAF
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) SGGGSTT
S
T
TTTSS





SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence RALVGEDNFFYILYFQEPGVADAELDGDPARTMRRMFGGLTSDPDAAHRMLQPGPAGFIDRLPEPEALPD
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TTTS

TTSTT




S
SS

S


SS

T
 .........220.........230.........240.........250.........260.........270.........280
Sequence WLTAEELDHYIAEFTRTGFTGGLNWYRNMDRNWELTEHLAGATITAPALFLAGAADPVLGFMRPERATEV
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) T


STTTTGGGSS

B
S
TT
GGGGTS

TTGGGT
 .........290.........300.........310.........
Sequence AVGPYRQVLLDGAGHWVQQERPQEVNAALIDFLRGLELQ
Predicted secondary structure















SS confidence






































Known secondary structure (DSSP) B
SS

TT

S
STT




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D