Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5cowA_

Fold library idPDB HeaderMoleculeTitle
c5cowA_1.60PDB header: hydrolaseChain: A: PDB Molecule: putative uncharacterized protein;


Added to library: Sat Feb 6 08:20:31 2016
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DKFTYLLLQPLTEATLSDAVNFIVEKYSAELPDEGDASLVVRSQLGCQFFFLVTRTLAHDQRELAKLVQT
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)
S


TT

STT
 .........80.........90.........100.........110.........120.........130.........140
Sequence LIPRPVRLEVFPGLQRSVFKSSVFLGHHIIQIFMGAKKPFQDWSFVGLAQDFECPWRRLAIAELLKKFSV
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) TS
STTTTT






TTTTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence SVVEKVFDNPVALIPQHESDNEALIELVTNALRFALWIVEFYETETNEKSIKELAFLDHSSKTLLIESFT
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) S

SSS


SSTT

TTTTT
TTSTTTTS
 .........220.........230....
Sequence KFLQGKDVKDQDHLKRIIDALEKS
Predicted secondary structure






SS confidence























Known secondary structure (DSSP) TTT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D