Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5cofA_

Fold library idPDB HeaderMoleculeTitle
c5cofA_1.35PDB header: unknown functionChain: A: PDB Molecule: uncharacterized protein;


Added to library: Sat Feb 6 08:20:45 2016
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SXSVPQTKAELLLAIDKNFSKLISYLNTIPPEITSDKSXDGHAKGTEXSVRDLVSYLLGWNALVVKWIAS
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)

SS

SS
GGGTT



SSTT

 .........80.........90.........100.........110.........120.........130.........140
Sequence DAKGLPVDFPETGYKWNQLGLLAQKFYSDYSELSYELLVAELQTVKNEIVNLINDRTDDILYGRPWYTKW
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TT



SSBTTB
TT
TTS
TS
SS
SBTTB
 .........150.........160.........170..
Sequence TXGRXISFNTSSPYANANGRLRKWAKNNNISL
Predicted secondary structure










SS confidence































Known secondary structure (DSSP)
TTTTT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D