Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5cdlA_

Fold library idPDB HeaderMoleculeTitle
c5cdlA_1.80PDB header: hydrolaseChain: A: PDB Molecule: proline dipeptidase;


Added to library: Thu Feb 9 12:12:07 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SSKXDQLRPVLGRAGVDALWVSAPANVRWLSGFTSAEDGKVLVSPDGATLYTDARYTVQAQEESSLPQYI
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)

TT
S
S

S
GGGTT
GGG
SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence ARPPATYEHAADTVRGLRVGFEAESLTVAELEDLRQAWPNSTLVALRGTLGGLRAVKTPEEIGAIRAAQD
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)

TTGGGGTT
TTTS

TTSSGGGTTTT
B

 .........150.........160.........170.........180.........190.........200.........210
Sequence LADRVYTEVRPXIRAGVRELDVAVEIETRLRRAGGESAFELIVASGPNGAKPHGHASKRVIEDGDLVTID
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) GGG
STT
BTT
SSS
GGGGG
SS



S
B

TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence XGARLGGYNSDXTRTVAVGTPSAEXKRVYDAVLEAEEAAIAAIRPGVRAADLDKLARDLLTRHGLGEAFA
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)
TT

SS


T

TT
BTT
TTSB
 .........290.........300.........310.........320.........330.........340.........
Sequence HSLGHGVGLEVHEGPGLRGTSQDVLEAGXVITIEPGAYLPGVGGVRIEDLILVTEDGYEVLSHSAKESV
Predicted secondary structure















































SS confidence




































































Known secondary structure (DSSP) S



SSSSS
STT


B

TTB

TTT
BTT


S





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D