Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ccvH_

Fold library idPDB HeaderMoleculeTitle
c5ccvH_3.60PDB header: transferaseChain: H: PDB Molecule: rna-directed rna polymerase ns5;


Added to library: Sat Feb 6 08:21:27 2016
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TLGEKWKKKLNQLSRKEFDLYKKSGITEVDRTEAKEGLKRGEITHHAVSRGSAKLQWFVERNMVIPEGRV
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
TTTTSS
TTSTT


TTT

SS

S
TTTS



 .........80.........90.........100.........110.........120.........130.........140
Sequence IDLGCGRGGWSYYCAGLKKVTEVRGYTKGGPGHEEPVPMSTYGWNIVKLMSGKDVFYLPPEKCDTLLCDI
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) S
TTSTT
SS


STTS







TTGGG
S

TTS





S

 .........150.........160.........170.........180.........190.........200.........210
Sequence SPSPTVEESRTIRVLKMVEPWLKNNQFCIKVLNPYMPTVIEHLERLQRKHGGMLVRNPLSRNSTHEMYWI
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)


GGG
SSSS
TT
TTTTTS



TTS
TT


 .........220.........230.........240.........250.........260.........270.........280
Sequence SNNIVSSVNMVSRLLLNRFTMTHRRPTIEKDVDLGAGTRHVNAEPETPNMDVIGERIKRIKEEHSSTWHY
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)


S











S


GGG
S



SSSSTTTT
B
 .........290.........300.........310.........320.........330.........340.........350
Sequence DDENPYKTWAYHGSYEVNGVVKLLTKPWDVVPMVTQTTPFGQQRVFKEKVDTRTPRPMPGTRKVMEITAE
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
TT


SSS


T

GGGGSTTT



TTTTS






 .........360.........370.........380.........390.........400.........410.........420
Sequence WLWRTLGRNKRPRLCTREEFTKKVSARAAVEDEEFWKLVDRERELHKLGKCGSCGARYLEFEALGFLNED
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TSS






TTT


SSS





TTS
STTTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence HWFSRENSYSGVEGEGLHKLGYILRDISKIPGGAMYADDTAGWDTRITEDDLHNEEKITQDPEHRQLANA
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) T
SSTTTTSSB
TTT
TTTTTS
SS
BB


BS


GGGG

 .........500.........510.........520.........530.........540.........550.........560
Sequence IFKLTYQNKVVKVQRPTPKGTVMDIISRKDQRGSGQVGTYGLNTFTNMEAQLIRQMEGEGVLSKADLENP
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) SSSSS
SS
SS


SS
TTTSS

S
 .........570.........580.........590.........600.........610.........620.........630
Sequence HPLEKKITQWLETKGVERLKRMAISGDDCVVKPIDDRFANALLALNDMGKVRKDIPQWQPSKGWHDWQQV
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) S

TTTTT

SSGGGTT

TT

BSSS
TTS



BS
GGG
 .........640.........650.........660.........670.........680.........690.........700
Sequence PFCSHHFHELIMKDGRKLVVPCRPQDELIGRWSLRETACLGKAYAQMWALMYFHRRDLRLASNAICSATT
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)

SS

TTS


TT


ST
TT


-
 .........710.........720.........730.........740.........750.........760.......
Sequence EDMLTVWNRVWIEDNPWMEDKTPVTTWEDVPYLGKREDQWCGSLIGLTSRATWAQNILTAIQQVRSL
Predicted secondary structure





































SS confidence


































































Known secondary structure (DSSP)

TTTS
TT






SSGGGS



TT

TTSTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D