Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5ccvH_

Fold library idPDB HeaderMoleculeTitle
c5ccvH_3.60PDB header: transferaseChain: H: PDB Molecule: rna-directed rna polymerase ns5;


Added to library: Sat Feb 6 08:21:27 2016
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TLGEKWKKKLNQLSRKEFDLYKKSGITEVDRTEAKEGLKRGEITHHAVSRGSAKLQWFVERNMVIPEGRV
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
TTTTSS
TTSTT


TTT

SS

S
TTTS



 .........80.........90.........100.........110.........120.........130.........140
Sequence IDLGCGRGGWSYYCAGLKKVTEVRGYTKGGPGHEEPVPMSTYGWNIVKLMSGKDVFYLPPEKCDTLLCDI
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) S
TTSTT
SS


STTS







TTGGG
S

TTS





S

 .........150.........160.........170.........180.........190.........200.........210
Sequence SPSPTVEESRTIRVLKMVEPWLKNNQFCIKVLNPYMPTVIEHLERLQRKHGGMLVRNPLSRNSTHEMYWI
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)


GGG
SSSS
TT
TTTTTS



TTS
TT


 .........220.........230.........240.........250.........260.........270.........280
Sequence SNNIVSSVNMVSRLLLNRFTMTHRRPTIEKDVDLGAGTRHVNAEPETPNMDVIGERIKRIKEEHSSTWHY
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)


S











S


GGG
S



SSSSTTTT
B
 .........290.........300.........310.........320.........330.........340.........350
Sequence DDENPYKTWAYHGSYEVNGVVKLLTKPWDVVPMVTQTTPFGQQRVFKEKVDTRTPRPMPGTRKVMEITAE
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
TT


SSS


T

GGGGSTTT



TTTTS






 .........360.........370.........380.........390.........400.........410.........420
Sequence WLWRTLGRNKRPRLCTREEFTKKVSARAAVEDEEFWKLVDRERELHKLGKCGSCGARYLEFEALGFLNED
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TSS






TTT


SSS





TTS
STTTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence HWFSRENSYSGVEGEGLHKLGYILRDISKIPGGAMYADDTAGWDTRITEDDLHNEEKITQDPEHRQLANA
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) T
SSTTTTSSB
TTT
TTTTTS
SS
BB


BS


GGGG

 .........500.........510.........520.........530.........540.........550.........560
Sequence IFKLTYQNKVVKVQRPTPKGTVMDIISRKDQRGSGQVGTYGLNTFTNMEAQLIRQMEGEGVLSKADLENP
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) SSSSS
SS
SS


SS
TTTSS

S
 .........570.........580.........590.........600.........610.........620.........630
Sequence HPLEKKITQWLETKGVERLKRMAISGDDCVVKPIDDRFANALLALNDMGKVRKDIPQWQPSKGWHDWQQV
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) S

TTTTT

SSGGGTT

TT

BSSS
TTS



BS
GGG
 .........640.........650.........660.........670.........680.........690.........700
Sequence PFCSHHFHELIMKDGRKLVVPCRPQDELIGRWSLRETACLGKAYAQMWALMYFHRRDLRLASNAICSATT
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)

SS

TTS


TT


ST
TT


-
 .........710.........720.........730.........740.........750.........760.......
Sequence EDMLTVWNRVWIEDNPWMEDKTPVTTWEDVPYLGKREDQWCGSLIGLTSRATWAQNILTAIQQVRSL
Predicted secondary structure





































SS confidence


































































Known secondary structure (DSSP)

TTTS
TT






SSGGGS



TT

TTSTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D