Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5c98B_

Fold library idPDB HeaderMoleculeTitle
c5c98B_1.45PDB header: unknown functionChain: B: PDB Molecule: agap007691-pb;


Added to library: Thu Feb 9 18:15:08 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DDAIVAANNKFTLEYFKACYDEKCNCAVSPYHVRLALSMFYPLAGAAVQEDFQVAFGLPEDVHAAIEQQQ
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)


TTS

GGGGGGB



SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence RLAQQLHDGQHLKALSFVLVEETLRLDSEFERLFHRTFQTTVEPVDLTDDIPSALAVNSFYQRANTEIED
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

SSSTTS
B
TSS

TT
TT
S
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence FIGEGDVFSLPPCHKLMLFSGVSVLTPLAIRFNPADTALELFQFINAPTQRVSTMHTTAFVRRCLHNELR
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)





SS



S
BSB


GGG


BTTBTT
TTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence CKVVDMPFDAASGLSMLVLLPYDGTELRQIVNSITPAHLAQIDERLQSCWTDLKLPKFFVREKTDPKQTL
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) B
GGG

TT






 .........290.........300.........310.........320.........330.........340.........350
Sequence GKLGYGGVFEIDDLHVFHDSGRTRLNGFIQHCYLAVSESGIPAPPDTPSEFEFHANRPFMFLIRRTMDGN
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) TT
TS

B

BSSS

B






B


TT


S

S
TTT

 .........360....
Sequence VLQVGNFSKYIDPD
Predicted secondary structure






SS confidence













Known secondary structure (DSSP)







Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D