Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5c2xB_

Fold library idPDB HeaderMoleculeTitle
c5c2xB_2.11PDB header: lyaseChain: B: PDB Molecule: deoxyribose-phosphate aldolase;


Added to library: Sat Feb 6 09:58:57 2016
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SDIKAVAQRALSLMDLTSLTNTETDQEIIDLCRQAKSPAGETAAICIFPRFIPVAKKALKAQQTPHIKIA
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)
T


S


TT
S

GGGTT
TTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence TVTNFPQGNDDLDIALAETRAAVAYGADEVDLVFPYRALIQGNETIGFDMVKVCKQACSGNAKLKVIIET
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) STTT

S
T
S

TT

TTT


 .........150.........160.........170.........180.........190.........200.........210
Sequence GELKSEELIRKASEIAINAGADFIKTSTGKVAINATPEAAKVMLTVIKNKNTAVGFKPAGGVRNADDAAI
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
ST
S


S
SS




TTS
BS


S
 .........220.........230.........240......
Sequence YLDLADNILGNEWADANHFRFGASSLLISLLDTLGH
Predicted secondary structure









SS confidence



































Known secondary structure (DSSP)
TTT
STTTB
STTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D