Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5c17A_

Fold library idPDB HeaderMoleculeTitle
c5c17A_1.24PDB header: lyaseChain: A: PDB Molecule: merb2;


Added to library: Sat Feb 6 08:23:48 2016
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KTELKKFYELLLAKLPKESVPILRTIFFSIRDGQAVTESSLINQTGINTKTVQSVVKILAQRQMIVREAD
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
S
TTTT

B



TTS
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence QKIVGALGLSIIPTTNQIHLGGRTLFAWCAISTLELSTALVADVDIHSRCAYTGEPIEVTVRNGKLAKTT
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)

TTSS

STTSST


TTT

TT
 .........150.........160.........170.........180.........190.........200......
Sequence PDSTVIWTVPFDSEAPWAGGTCKQIHYFSSVEHANKWKEEHPKLQGEIMTLEQALSFGNELKKFLS
Predicted secondary structure



























SS confidence

































































Known secondary structure (DSSP) STT




TTS
TTTTGGGG
S
STT



T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D