Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5b86A_

Fold library idPDB HeaderMoleculeTitle
c5b86A_3.02PDB header: immune systemChain: A: PDB Molecule: tumor necrosis factor alpha-induced protein 2;


Added to library: Thu Feb 9 16:39:49 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DGPLPTVEELKEALEHGRLEVAWQVLALERQLEAAAAAGGXSNEELVWRQSKVEALYVLLCDQVLGVLRR
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP)




STT

TTTS
S
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence PLEAAPERLSQALAVVSQEELEDRRASGGPLAAALEATRPRRWLQRWRGVVAEVAAERLDAQPGRSEAES
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TTS
STTTTTS



TTS






TTS




 .........150.........160.........170.........180.........190.........200.........210
Sequence RFLHXGRTXKEDLEVVVERLKPLFPDEFNVVRTYAESYHYHFASHLCALAQFELCERDTYLLLLWVQNLY
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) TS
TTT
SSS


T
 .........220.........230.........240.........250.........260.........270.........280
Sequence PNDILNSPKLAQELQGVGLGSLLPPKQIRLLEAXFLSNEVTSVKQLXARALELESQRWTQDVAPQSLDGH
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TTTSSST



SS
TT


SSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence CHSELAIDILQIISQGQTKAENITSDVGXQIKQLLLVELAALLRSYQRAFDEFLEKSKLLRNYRVNIXAN
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP)
TT
S

SSTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence INNCLFFWTSVEQKWQISHDSLNRLLEPLKDLKAHGFDTLLQSLFLDLKPLFKKFTQTRWANPVETLEEI
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP) T


TTTTTS
 .........430.........440.........450.........460.........470.........480.........490
Sequence ITTVSSSLPEFSELQDCFREELXETVHLHLVKEYIIRLCKRRLVLKTAEQQQQLARHILANADAIQGFCT
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) TTTTGGGSS
TSS




S
 .........500.........510.........520.........530.........540.........550.........560
Sequence ENGSTATWLHRALPXIAEIIRLQDSSAIKIEVATYATWYPDFSKGHLNAILAIKGNLPSSEVRSIRNILD
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) T



GGGGTT

SS
S


GGGSS
SSTT
 .........570.........
Sequence INTGVQEPPRPLFSLIKVT
Predicted secondary structure

















SS confidence


















Known secondary structure (DSSP)


SS




SSSSS




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D