Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5b6lA_

Fold library idPDB HeaderMoleculeTitle
c5b6lA_2.80PDB header: hydrolaseChain: A: PDB Molecule: putative serine protease hhoa;


Added to library: Thu Feb 9 17:30:48 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SFVAAAVSRSGPAVVRIDGQGSGFIIDNSGIILTNAHVVDGASVVVTLRDGRTFDGQVRGTDEVTDLAVV
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)
GGG



TTT
GGGS
S



TTS

TTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence KIEPQGSALPVAPLGTSSNLQVGDWAIAVGNPVGLDNTVTLGIISTLGVEFIQTDAAINPGNSGGPLLNA
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)



SS





B

GGG

TT

SSSSS




SS


TTTTTS
T
 .........150.........160.........170.........180.........190.........200.........210
Sequence RGEVIGINTAIGIGFAIPIDQAKAIQNTLAAGGTVPHPYIGVQMMNITVDQAQQNNRNPNSPFIIPEVDG
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) TS




TSS







TT
TT
SS


SSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence ILVMRVLPGTPAERAGIRRGDVIVAVDGTPISDGARLQRIVEQAGLNKALKLDLLRGDRRLSLTVQTAQL
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
TTSTT

TT
SSS
B


S
SS
TT

 .
Sequence R
Predicted secondary structure
SS confidence
Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D