Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5b54D_

Fold library idPDB HeaderMoleculeTitle
c5b54D_2.07PDB header: transferaseChain: D: PDB Molecule: cysteine synthase;


Added to library: Sat Apr 29 08:20:24 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MYLENLVGTPMLELIFDYGEERRIFVNESYNLTGSIKDRMAFYTLAYENEIGAPIVEATSGNTGIAFSAM
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

GGGG








TTSSTTSBT










SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence GAILGHPVIIYMPDWMSEERSLIRSFGAIILVSREGGFLGSIETEFANNPDTYLPSQFSNLYNSEAHYYG
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TT

TTS
TT

TT












TT
B


TTT
T
 .........150.........160.........170.........180.........190.........200.........210
Sequence IGLEIVNEMSLNLNIDGFVAGVGTGGTVMGIGRIENFSNAICPLEPLNSPTLSTGYVAHRIEGISDEFIP
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)








SSS





TT

TTS







TTS

SS

 .........220.........230.........240.........250.........260.........270.........280
Sequence DLVLDLDNVVSVDDGDAIVMAQLACGLGVGISSGANFIGALMLQNLGDSVIVTVFPDDNYLSTDLMREEV
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TT


























B


TTSGGGS


 .........290......
Sequence EDFLSDITLEINVLRV
Predicted secondary structure













SS confidence















Known secondary structure (DSSP)

S



B






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D